Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57040 196 / 9e-63 ATRR4, ARR9 RESPONSE REGULATOR 4, response regulator 9 (.1) AT2G41310 187 / 1e-59 ARR8, ATRR3 RESPONSE REGULATOR 8, response regulator 3 (.1) AT1G59940 163 / 3e-50 ARR3 response regulator 3 (.1) AT1G10470 160 / 1e-48 IBC7, ATRR1, ARR4, MEE7 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1) AT3G48100 156 / 6e-48 ATRR2, IBC6, ARR5 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) AT1G19050 153 / 2e-46 ARR7 response regulator 7 (.1) AT1G74890 153 / 2e-46 ARR15 response regulator 15 (.1) AT3G56380 149 / 8e-46 ARR17 response regulator 17 (.1) AT5G62920 150 / 2e-45 ARR6 response regulator 6 (.1) AT2G40670 146 / 3e-44 ARR16 response regulator 16 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002750 [exp] 312 / 2e-108 AT3G57040 212 / 4e-69 RESPONSE REGULATOR 4, response regulator 9 (.1) Lus10039524 [exp] 235 / 2e-78 AT3G57040 222 / 2e-73 RESPONSE REGULATOR 4, response regulator 9 (.1) Lus10004243 [exp] 162 / 8e-50 AT3G48100 220 / 2e-73 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) Lus10042153 [exp] 158 / 3e-48 AT3G48100 213 / 1e-70 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) Lus10030664 [exp] 158 / 2e-47 AT1G10470 206 / 2e-65 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1) Lus10030822 [exp] 158 / 2e-47 AT1G59940 201 / 2e-64 response regulator 3 (.1) Lus10029211 [exp] 155 / 9e-47 AT1G10470 211 / 4e-68 maternal effect embryo arrest 7, INDUCED BY CYTOKININ 7, RESPONCE REGULATOR 1, response regulator 4 (.1) Lus10007885 [exp] 113 / 8e-31 AT2G41310 143 / 1e-42 RESPONSE REGULATOR 8, response regulator 3 (.1) Lus10030359 [exp] 112 / 1e-30 AT2G41310 142 / 3e-42 RESPONSE REGULATOR 8, response regulator 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T124806 [exp] 215 / 6e-71 AT2G41310 232 / 6e-78 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.003G197466 [exp] 214 / 1e-70 AT2G41310 232 / 5e-78 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.001G027000 [exp] 211 / 4e-69 AT2G41310 203 / 2e-66 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.016G038000 [exp] 199 / 5e-64 AT2G41310 242 / 2e-81 RESPONSE REGULATOR 8, response regulator 3 (.1) Potri.006G041100 [exp] 197 / 2e-63 AT3G57040 273 / 4e-93 RESPONSE REGULATOR 4, response regulator 9 (.1) Potri.002G082200 [exp] 165 / 1e-50 AT3G57040 180 / 1e-56 RESPONSE REGULATOR 4, response regulator 9 (.1) Potri.010G037800 [exp] 157 / 3e-47 AT1G59940 202 / 5e-65 response regulator 3 (.1) Potri.019G058900 [exp] 153 / 5e-47 AT3G56380 223 / 5e-76 response regulator 17 (.1) Potri.015G070000 [exp] 155 / 7e-47 AT3G48100 231 / 1e-77 INDUCED BY CYTOKININ 6, ARABIDOPSIS THALIANA RESPONSE REGULATOR 2, response regulator 5 (.1) Potri.019G133600 [exp] 147 / 9e-45 AT3G56380 183 / 2e-60 response regulator 17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0304 [flax] [poplar] CheY PF00072 [flax] [poplar] Response_reg Response regulator receiver domain
Representative CDS sequence Show only first row Show all	>Lus10016334 pacid=23161851 polypeptide=Lus10016334 locus=Lus10016334.g ID=Lus10016334.BGIv1.0 annot-version=v1.0 ATGGCTATGGCTGTTGCTCAACCTCATCCTGTTCATCACCACCACAACCACCACAAGTTCCATGTTCTTGCTGTTGATGACAGTATCATTGACAGAAAGT TGATTGAGAGGCTCCTCAAGACCTCTTCCTATCAAGTGACAGCAGTTGATTCAGGGAGTAAAGCCCTGGAGTTTCTTGGCCTCAAGAACAACAACACTAG TGATCATGATGATGATGAACAAGAACAAGTTATGGAGATGGATGATTCATCTAACTCTGCCTCTAATCATGATCTTGATCCTGAAGTTAATCTCATCATT ACTGATTACTGTATGCCTGGAATGACTGGCTATGACCTCCTCAGAAAGATCAAGGAATCCAAGTCATTCAAGGACATCCCAGTTGTGATCATGTCTTCAG AGAATGTACCATCCAGGATCAATAGGTGCTTGCAAGAAGGAGCTGAGGAGTTCTTTCTGAAGCCAGTTCAGTTGTCAGATGTGAACAAACTGAAACCACA TCTGTTGAGGAAGGGATCATCAAGATCCAGCAGTAATGAAGATGGAGATTTAGAGGATGAGATGGTCAAAACCAGCTACAGTAACACTTCTTCTAACAAC AAGAGAAAAGGGGAGGAAGAAGAGGAAGAAGAAATTCAATCACAAGACAAGTCAAGAGCCAAGTACAACAGCTTGCTTCCAACTTCAATGAAACAATGA
AA sequence Show only first row Show all	>Lus10016334 pacid=23161851 polypeptide=Lus10016334 locus=Lus10016334.g ID=Lus10016334.BGIv1.0 annot-version=v1.0 MAMAVAQPHPVHHHHNHHKFHVLAVDDSIIDRKLIERLLKTSSYQVTAVDSGSKALEFLGLKNNNTSDHDDDEQEQVMEMDDSSNSASNHDLDPEVNLII TDYCMPGMTGYDLLRKIKESKSFKDIPVVIMSSENVPSRINRCLQEGAEEFFLKPVQLSDVNKLKPHLLRKGSSRSSSNEDGDLEDEMVKTSYSNTSSNN KRKGEEEEEEEIQSQDKSRAKYNSLLPTSMKQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G57040		ATRR4, ARR9	RESPONSE REGULATOR 4, response...		Lus10016334 [exp]	0	1
AT3G57040		ATRR4, ARR9	RESPONSE REGULATOR 4, response...		Lus10002750 [exp]	1.0	0.9607
AT3G29250		AtSDR4	short-chain dehydrogenase redu...		Lus10022562 [exp]	2.0	0.9560
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10002892 [exp]	3.5	0.9333
AT3G26210		CYP71B23	"cytochrome P450, family 71, s...		Lus10012767 [exp]	4.5	0.9391
AT3G50920			Phosphatidic acid phosphatase ...		Lus10028327 [exp]	7.9	0.9522
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10001109 [exp]	8.2	0.9177
AT1G28350			Nucleotidylyl transferase supe...		Lus10009938 [exp]	9.8	0.8861
AT5G05320			FAD/NAD(P)-binding oxidoreduct...		Lus10034475 [exp]	10.4	0.9520
AT4G23430		AtTic32-IVa	translocon at the inner envelo...		Lus10024685 [exp]	10.9	0.9332
AT2G41705			camphor resistance CrcB family...		Lus10025621 [exp]	15.9	0.8784

Compare expression of checked genes

Lus10016334 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.