Lus10016336 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G23290 253 / 3e-88 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
AT1G70600 249 / 2e-86 Ribosomal protein L18e/L15 superfamily protein (.1)
AT1G12960 130 / 3e-40 Ribosomal protein L18e/L15 superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004617 290 / 1e-102 AT1G23290 258 / 5e-90 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10026698 286 / 6e-101 AT1G23290 256 / 2e-89 RIBOSOMAL PROTEIN L27A, Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10036855 281 / 3e-99 AT1G70600 255 / 8e-89 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10006207 279 / 3e-98 AT1G70600 254 / 1e-88 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10039528 277 / 2e-97 AT1G70600 264 / 2e-92 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10024161 275 / 1e-96 AT1G70600 263 / 6e-92 Ribosomal protein L18e/L15 superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G202300 266 / 2e-93 AT1G70600 238 / 5e-82 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.008G187000 264 / 2e-92 AT1G70600 238 / 3e-82 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.016G069000 263 / 4e-92 AT1G70600 268 / 7e-94 Ribosomal protein L18e/L15 superfamily protein (.1)
Potri.010G045800 263 / 6e-92 AT1G70600 237 / 1e-81 Ribosomal protein L18e/L15 superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0588 Ribos_L15p_L18e PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Representative CDS sequence
>Lus10016336 pacid=23161885 polypeptide=Lus10016336 locus=Lus10016336.g ID=Lus10016336.BGIv1.0 annot-version=v1.0
ATGGCTACCGGCTTGAAGAAGAACCGCAAGAAGAGAGGCCACGTCAGCGCTGGACACGGCCGTGTCGGGAAGCACAGGAAGCATCCCGGAGGTCGCGGTA
ACGCTGGAGGCATGCACCACCACCGTATCCTCTTCGACAAGTACCATCCCGGTTACTTCGGGAAGGTCGGCATGAGGTACTTCCACAAGCTCAAGAACAG
GTTCTTCTGCCCCATCGTCAACATCGACAAGCTCTGGTCGATGGTACCTCAGGAGGTGAAGGACAAAGCCGGAAAGGATGGCGCCAGTGCTCCGATGATC
GACGTCACTCAGTTCGGGTACTTCAAGGTCCTTGGGAAGGGCGTCTTGCCTGATAATCAGCCCATCGTTGTGAAGGCTAAGCTCGTGTCCAACCCCGCCG
AGAGGAAGATCAAGGAAGCCGGCGGTGCTGTTGTCCTCACTGCCTAG
AA sequence
>Lus10016336 pacid=23161885 polypeptide=Lus10016336 locus=Lus10016336.g ID=Lus10016336.BGIv1.0 annot-version=v1.0
MATGLKKNRKKRGHVSAGHGRVGKHRKHPGGRGNAGGMHHHRILFDKYHPGYFGKVGMRYFHKLKNRFFCPIVNIDKLWSMVPQEVKDKAGKDGASAPMI
DVTQFGYFKVLGKGVLPDNQPIVVKAKLVSNPAERKIKEAGGAVVLTA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G23290 RPL27A, RPL27AB RIBOSOMAL PROTEIN L27A, Riboso... Lus10016336 0 1
AT3G49910 Translation protein SH3-like f... Lus10028537 1.0 0.9710
AT4G36130 Ribosomal protein L2 family (.... Lus10041923 3.0 0.9616
AT5G48760 Ribosomal protein L13 family p... Lus10007137 3.5 0.9621
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10006207 3.9 0.9282
AT5G43970 ATTOM22-V, TOM2... TRANSLOCASE OUTER MITOCHONDRIA... Lus10022876 4.2 0.9273
AT3G57490 Ribosomal protein S5 family pr... Lus10014909 4.5 0.9499
AT3G49910 Translation protein SH3-like f... Lus10011540 6.9 0.9137
AT5G67630 P-loop containing nucleoside t... Lus10019267 7.3 0.9103
AT5G44500 Small nuclear ribonucleoprotei... Lus10038421 7.7 0.9181
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Lus10005586 9.0 0.9227

Lus10016336 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.