Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30880 94 / 5e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G33550 82 / 3e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G56480 54 / 2e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G32280 53 / 4e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019770 [exp] 207 / 9e-71 AT4G30880 98 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10019029 [exp] 69 / 4e-16 AT4G33550 106 / 7e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10005010 [exp] 67 / 1e-15 AT4G33550 89 / 8e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10027345 [exp] 56 / 5e-11 AT4G33550 81 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10019030 [exp] 56 / 8e-11 AT4G33550 79 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10005011 [exp] 54 / 2e-10 AT4G33550 78 / 1e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G023200 [exp] 112 / 4e-33 AT4G30880 115 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G023300 [exp] 100 / 2e-28 AT4G30880 99 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G049300 [exp] 72 / 4e-17 AT4G33550 81 / 6e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.009G048900 [exp] 64 / 3e-14 AT4G30880 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G049000 [exp] 62 / 3e-13 AT4G30880 75 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G048800 [exp] 56 / 6e-11 AT4G33550 72 / 5e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G084000 [exp] 51 / 3e-09 AT4G33550 54 / 1e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10016357 pacid=23161891 polypeptide=Lus10016357 locus=Lus10016357.g ID=Lus10016357.BGIv1.0 annot-version=v1.0 ATGTCATCAATCACCAAACTAGCTCTACTAGTCGTGACCATCACCGCGGTGATGGTCGGTCGCTCCGACGGCCAAGGAATCGGGTGTGCAGGCGACGTGC CAGGCTTGGTAATGCAGTGTGCTAGGTTCGTCCCTAGGATCGGCCCTGTCACCGACCCTTCCTCTCCGTGTTGCACCGCCCTAAGGACCGTGGACATCCC CTGCGTCTGCAGTCGAATCCCCAACGAGGTCGCGGCCATGGTCGACATGAACAAGGTCGTCCATGTGGTCGACTTCTGCGGTGTCGTCCTCCCCCATGGC CTCAAATGTGGAAATTTGACAGTTCCTGGAGCAGCGGAGAAGAAGCTGCATGCTTGA
AA sequence Show only first row Show all	>Lus10016357 pacid=23161891 polypeptide=Lus10016357 locus=Lus10016357.g ID=Lus10016357.BGIv1.0 annot-version=v1.0 MSSITKLALLVVTITAVMVGRSDGQGIGCAGDVPGLVMQCARFVPRIGPVTDPSSPCCTALRTVDIPCVCSRIPNEVAAMVDMNKVVHVVDFCGVVLPHG LKCGNLTVPGAAEKKLHA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G30880			Bifunctional inhibitor/lipid-t...		Lus10016357 [exp]	0	1
					Lus10023136 [exp]	1.4	0.9785
AT5G16600	MYB	ATMYB43	myb domain protein 43 (.1)		Lus10010974 [exp]	2.8	0.9569
					Lus10011497 [exp]	8.1	0.9821
AT4G27390			unknown protein		Lus10037884 [exp]	14.4	0.9572
AT2G40780			Nucleic acid-binding, OB-fold-...		Lus10012866 [exp]	17.9	0.8227
					Lus10011061 [exp]	19.2	0.9427
					Lus10020274 [exp]	19.6	0.8875
					Lus10011759 [exp]	21.1	0.9427
AT3G49680		ATBCAT-3 ,BCAT3	branched-chain aminotransferas...		Lus10007246 [exp]	21.8	0.9179
AT4G12320		CYP706A6	"cytochrome P450, family 706, ...		Lus10024572 [exp]	22.4	0.7906

Compare expression of checked genes

Lus10016357 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.