Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G63460 179 / 1e-53 EMB2221 transducin family protein / WD-40 repeat family protein (.1.2.3) AT1G18830 150 / 1e-43 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019751 [exp] 213 / 3e-73 AT3G63460 181 / 2e-54 transducin family protein / WD-40 repeat family protein (.1.2.3) Lus10016373 [exp] 215 / 3e-66 AT3G63460 1299 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2.3) Lus10005323 [exp] 200 / 3e-62 AT3G63460 885 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2.3) Lus10039578 [exp] 202 / 1e-61 AT3G63460 1380 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G055400 [exp] 181 / 2e-54 AT3G63460 1351 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2.3) Potri.001G260900 [exp] 179 / 1e-53 AT3G63460 1347 / 0.0 transducin family protein / WD-40 repeat family protein (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016374 pacid=23161881 polypeptide=Lus10016374 locus=Lus10016374.g ID=Lus10016374.BGIv1.0 annot-version=v1.0 ATGGCGTGTATCAAGTCCGTTAACAGATCGGCGTCGGTTGCCCTGGCGCCGGACGCTCCTTATTTGGCCGCCGGGACGATGGCCGGCGCGGTGGATCTGT CGTTCAGCTCCTCGGCCAACATCGAGATTTTCAAGCTCGATTTTCAGTCGGATGATCCTGATCTCCCGTTGGTTGGGGAGTCGCAGAGCACCGAGAGATT TAACCGTCTCGCTTGGGGGAAAAACGGATCCGGCTCCGAGCAGTATGGTATGGGACTCATTGCAGGTGGCCTTGTGGATGGGACTATTGGTATCTGGAAT CCATCAGCGTTGATCCGGTAA
AA sequence Show only first row Show all	>Lus10016374 pacid=23161881 polypeptide=Lus10016374 locus=Lus10016374.g ID=Lus10016374.BGIv1.0 annot-version=v1.0 MACIKSVNRSASVALAPDAPYLAAGTMAGAVDLSFSSSANIEIFKLDFQSDDPDLPLVGESQSTERFNRLAWGKNGSGSEQYGMGLIAGGLVDGTIGIWN PSALIR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G63460		EMB2221	transducin family protein / WD...		Lus10016374 [exp]	0	1
AT1G58250		SAB	SABRE, Golgi-body localisation...		Lus10024283 [exp]	1.0	0.9837
AT2G21390			Coatomer, alpha subunit (.1)		Lus10035884 [exp]	1.4	0.9774
AT5G27970			ARM repeat superfamily protein...		Lus10004117 [exp]	4.6	0.9694
AT5G27970			ARM repeat superfamily protein...		Lus10004116 [exp]	5.0	0.9675
AT2G07360			SH3 domain-containing protein ...		Lus10027587 [exp]	5.9	0.9636
AT5G10470		KAC1, KCA1	KINESIN CDKA;1 ASSOCIATED 1, k...		Lus10035941 [exp]	6.0	0.9685
AT3G02260		CRM1, TIR3, LPR...	UMBRELLA 1, TRANSPORT INHIBITO...		Lus10000087 [exp]	9.8	0.9663
AT2G46520			cellular apoptosis susceptibil...		Lus10005969 [exp]	9.8	0.9544
ATMG00080		ATMG00080.1, RP...	ribosomal protein L16 (.1)		Lus10004083 [exp]	10.2	0.9628
AT3G07100		AtSEC24A, SEC24...	ENDOPLASMIC RETICULUM MORPHOLO...		Lus10013101 [exp]	10.2	0.9501

Compare expression of checked genes

Lus10016374 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.