Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60910 163 / 1e-51 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT3G17365 102 / 5e-28 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) AT4G34360 64 / 2e-13 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT2G31740 41 / 5e-05 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016376 [exp] 206 / 2e-68 AT3G60910 327 / 2e-113 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10019750 [exp] 201 / 2e-66 AT3G60910 394 / 3e-140 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10016656 [exp] 44 / 7e-06 AT2G31740 895 / 0.0 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G261000 [exp] 166 / 9e-53 AT3G60910 387 / 2e-137 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.009G055600 [exp] 161 / 1e-50 AT3G60910 378 / 1e-133 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.010G153200 [exp] 111 / 2e-31 AT3G17365 313 / 1e-108 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) Potri.004G150200 [exp] 73 / 2e-16 AT4G34360 385 / 1e-136 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.001G317700 [exp] 47 / 4e-07 AT2G31740 886 / 0.0 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF05724 [flax] [poplar] TPMT Thiopurine S-methyltransferase (TPMT)
Representative CDS sequence Show only first row Show all	>Lus10016375 pacid=23161902 polypeptide=Lus10016375 locus=Lus10016375.g ID=Lus10016375.BGIv1.0 annot-version=v1.0 ATGAGGGATGAGTCGAGCTTGAACACATACAACTATGGCGACGCACTGTATTGGGACGCTCGATATGTGGAAGAGAGTGGGAGTTTCGATTGGTATCAGC GTTACTCTTCCCTTCGTCCTTTCGTCCGCCACTACGCACCTACTTCATCTCCCGTCCTCATGGTTGGCTGTGGCAATGCCCTGATGTCAGAGGACATGGT GAAGGATGGATATGAAGACATAATGAACATTGATATCTCTTCAGTGGCAATTGAAATGATGAGCAAAAAATATGAGTACATCCCTCAGCTCAAATGTATC CTCTTTGGGGAAACCACTTTTAGTTTCTGGATCTACATCATGTAG
AA sequence Show only first row Show all	>Lus10016375 pacid=23161902 polypeptide=Lus10016375 locus=Lus10016375.g ID=Lus10016375.BGIv1.0 annot-version=v1.0 MRDESSLNTYNYGDALYWDARYVEESGSFDWYQRYSSLRPFVRHYAPTSSPVLMVGCGNALMSEDMVKDGYEDIMNIDISSVAIEMMSKKYEYIPQLKCI LFGETTFSFWIYIM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G60910			S-adenosyl-L-methionine-depend...		Lus10016375 [exp]	0	1
AT3G60910			S-adenosyl-L-methionine-depend...		Lus10016376 [exp]	36.1	0.5925
AT5G63640			ENTH/VHS/GAT family protein (....		Lus10022667 [exp]	42.9	0.6360
AT1G09160			Protein phosphatase 2C family ...		Lus10020666 [exp]	44.0	0.6231
AT4G30920		AtLAP2, LAP2	leucyl aminopeptidase 2, Cytos...		Lus10036266 [exp]	55.7	0.6200

Compare expression of checked genes

Lus10016375 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.