Lus10016385 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G29850 171 / 1e-55 Eukaryotic protein of unknown function (DUF872) (.1)
AT2G19350 163 / 2e-52 Eukaryotic protein of unknown function (DUF872) (.1)
AT3G29170 61 / 5e-12 Eukaryotic protein of unknown function (DUF872) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019737 209 / 2e-70 AT4G29850 167 / 3e-55 Eukaryotic protein of unknown function (DUF872) (.1)
Lus10039596 179 / 1e-58 AT4G29850 169 / 3e-56 Eukaryotic protein of unknown function (DUF872) (.1)
Lus10007465 72 / 2e-16 AT3G29170 125 / 2e-38 Eukaryotic protein of unknown function (DUF872) (.1)
Lus10028939 47 / 3e-06 AT3G29170 80 / 3e-18 Eukaryotic protein of unknown function (DUF872) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G133500 171 / 2e-55 AT4G29850 154 / 3e-50 Eukaryotic protein of unknown function (DUF872) (.1)
Potri.006G072000 167 / 3e-54 AT4G29850 176 / 6e-59 Eukaryotic protein of unknown function (DUF872) (.1)
Potri.006G053300 75 / 1e-17 AT3G29170 132 / 3e-41 Eukaryotic protein of unknown function (DUF872) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05915 DUF872 Eukaryotic protein of unknown function (DUF872)
Representative CDS sequence
>Lus10016385 pacid=23161811 polypeptide=Lus10016385 locus=Lus10016385.g ID=Lus10016385.BGIv1.0 annot-version=v1.0
ATGGCTCGGCGCCATGGGGTGCCGGCAATGCAGCGGCGGTACGGTGGCGCGGCAGCAATGGTGCAACGGTCTAACGGAGGCATGGCAACCTCGATGCAAC
GGCGCAGTGGCAGTGTTGGCGGCGATGATTCAACTGCGGCGGTGGCAATGCGTCACAGTCACAAGCAAGCCAACCGCAGCTTTCATACACCACCCGCCTC
CTTCAAAGATCCGTGCTTGAACCAAACACCCACTCAGCTCGAAATGGCGTATGTTGATCACGCTTTTTCAATCACAGACGACGACGATTTGATGTTGGAA
GGACCTTACAGCACCAGCAACCGTGCTCCGATCAAGGAGATCGCCCTCGCCGTCTCGCTACTCGTCTTCGGCGTCGTCGGTATCCTAGCCGGCTTTTTCA
TGGTCTCCAACAGAGTCGGCGGTGACCGAGCCCACGGGATGTTCTTCGTGATATTGGGGGTGATTCTCTTCATACCGGGGTTCTATTACACCAGGATTGC
TTACTACGCTTACAAAGGATACAAAGGCTTCTCCTTTTCCAACATTCCTCCTGTATGA
AA sequence
>Lus10016385 pacid=23161811 polypeptide=Lus10016385 locus=Lus10016385.g ID=Lus10016385.BGIv1.0 annot-version=v1.0
MARRHGVPAMQRRYGGAAAMVQRSNGGMATSMQRRSGSVGGDDSTAAVAMRHSHKQANRSFHTPPASFKDPCLNQTPTQLEMAYVDHAFSITDDDDLMLE
GPYSTSNRAPIKEIALAVSLLVFGVVGILAGFFMVSNRVGGDRAHGMFFVILGVILFIPGFYYTRIAYYAYKGYKGFSFSNIPPV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G29850 Eukaryotic protein of unknown ... Lus10016385 0 1
AT4G29850 Eukaryotic protein of unknown ... Lus10019737 2.0 0.8552
AT2G31510 ATARI7, ARI7 ARABIDOPSIS ARIADNE 7, ARIADNE... Lus10027027 2.2 0.8720
AT2G48010 RKF3 receptor-like kinase in in flo... Lus10042678 3.7 0.8425
AT4G25000 AMY1, AMY3, ATA... alpha-amylase-like (.1) Lus10042655 5.0 0.8180
AT2G01850 ATXTH27, EXGT-A... XYLOGLUCAN ENDOTRANSGLUCOSYLAS... Lus10013240 5.5 0.8459
AT4G13510 ATAMT1;1, AMT1;... ARABIDOPSIS THALIANA AMMONIUM ... Lus10004403 5.7 0.8360
AT2G19830 VPS32, SNF7.2 SNF7 family protein (.1) Lus10012921 8.7 0.8545
AT1G07040 unknown protein Lus10030795 11.3 0.8525
AT5G17280 unknown protein Lus10028356 13.0 0.8197
AT4G36160 NAC ANAC076, VND2 VASCULAR-RELATED NAC-DOMAIN 2,... Lus10015312 14.4 0.8409

Lus10016385 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.