Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64010 43 / 2e-06 Serine protease inhibitor (SERPIN) family protein (.1) AT1G62160 43 / 3e-06 Serine protease inhibitor (SERPIN) family protein (.1) AT1G64030 42 / 4e-06 ATSRP3 serpin 3 (.1) AT1G62170 42 / 7e-06 Serine protease inhibitor (SERPIN) family protein (.1), Serine protease inhibitor (SERPIN) family protein (.2) AT2G26390 40 / 3e-05 Serine protease inhibitor (SERPIN) family protein (.1) AT2G25240 39 / 9e-05 Serine protease inhibitor (SERPIN) family protein (.1) AT2G14540 38 / 0.0001 ATSRP2 serpin 2 (.1) AT3G45220 37 / 0.0005 Serine protease inhibitor (SERPIN) family protein (.1) AT2G35580 37 / 0.0005 Serine protease inhibitor (SERPIN) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005089 [exp] 50 / 8e-09 AT1G47710 306 / 2e-101 Serine protease inhibitor (SERPIN) family protein (.1) Lus10019009 [exp] 50 / 1e-08 AT1G47710 209 / 9e-64 Serine protease inhibitor (SERPIN) family protein (.1) Lus10034362 [exp] 49 / 3e-08 AT1G47710 274 / 1e-89 Serine protease inhibitor (SERPIN) family protein (.1) Lus10034364 [exp] 43 / 3e-06 AT1G47710 296 / 4e-97 Serine protease inhibitor (SERPIN) family protein (.1) Lus10023541 [exp] 41 / 1e-05 AT1G62170 120 / 1e-31 Serine protease inhibitor (SERPIN) family protein (.1), Serine protease inhibitor (SERPIN) family protein (.2) Lus10039336 [exp] 41 / 2e-05 AT2G26390 105 / 2e-25 Serine protease inhibitor (SERPIN) family protein (.1) Lus10002792 [exp] 39 / 7e-05 AT1G47710 495 / 6e-176 Serine protease inhibitor (SERPIN) family protein (.1) Lus10005087 [exp] 39 / 8e-05 AT2G26390 44 / 6e-10 Serine protease inhibitor (SERPIN) family protein (.1) Lus10032754 [exp] 38 / 0.0002 AT1G47710 487 / 1e-172 Serine protease inhibitor (SERPIN) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G100900 [exp] 48 / 3e-08 AT1G47710 337 / 2e-113 Serine protease inhibitor (SERPIN) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00079 [flax] [poplar] Serpin Serpin (serine protease inhibitor)
Representative CDS sequence Show only first row Show all	>Lus10016386 pacid=23161849 polypeptide=Lus10016386 locus=Lus10016386.g ID=Lus10016386.BGIv1.0 annot-version=v1.0 ATGGGGCCTTCACGGAGATGCTCGCTGGTGGGAATGGCGAACGGTACGGAAGCTGGTGCTGCCTCGGCAGTGGTCCCTATGTCCTGTTCTTCCGGTTATG AGCCCCCGGTCCCCACTGAGGAATACATTGCGGACCACCCGTTCATGTTCATGATCGTGGAGGAGGATTCGGAAGCTGTGATTTCCGCCGGAGCTGTGTT CAATCCTCTAGATCAGTAG
AA sequence Show only first row Show all	>Lus10016386 pacid=23161849 polypeptide=Lus10016386 locus=Lus10016386.g ID=Lus10016386.BGIv1.0 annot-version=v1.0 MGPSRRCSLVGMANGTEAGAASAVVPMSCSSGYEPPVPTEEYIADHPFMFMIVEEDSEAVISAGAVFNPLDQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10016386 [exp]	0	1
AT1G53200			unknown protein		Lus10011648 [exp]	3.5	0.7223
AT5G65020		ANNAT2	annexin 2 (.1.2)		Lus10024054 [exp]	8.9	0.6120
AT5G01660			unknown protein		Lus10002863 [exp]	11.0	0.6786
AT1G04160		XI-B, XI-8, ATX...	MYOSIN XI-8, ARABIDOPSIS THALI...		Lus10032596 [exp]	13.0	0.6505
AT5G37820		NIP4;2, NLM5	NODULIN- 26-LIKE MAJOR INTRINS...		Lus10025744 [exp]	23.1	0.6608
AT5G20080			FAD/NAD(P)-binding oxidoreduct...		Lus10014491 [exp]	30.4	0.5691
AT1G01490			Heavy metal transport/detoxifi...		Lus10024670 [exp]	41.9	0.6464
					Lus10029249 [exp]	63.2	0.5758
AT2G24400			SAUR-like auxin-responsive pro...		Lus10033348 [exp]	63.4	0.5794
AT1G77460			Armadillo/beta-catenin-like re...		Lus10029690 [exp]	68.4	0.5533

Compare expression of checked genes

Lus10016386 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.