Plant FIBer expression Database

Lus10016415 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52105 81 / 3e-22 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019704
[exp]
132 / 1e-42 AT3G52105 80 / 6e-22 unknown protein
Lus10029521
[exp]
109 / 2e-33 AT3G52105 85 / 8e-24 unknown protein
Lus10012208
[exp]
77 / 1e-20 AT3G52105 70 / 5e-18 unknown protein
Lus10042363
[exp]
76 / 5e-20 AT3G52105 75 / 6e-20 unknown protein
Lus10011321
[exp]
75 / 9e-20 AT3G52105 72 / 1e-18 unknown protein
Lus10026305
[exp]
74 / 2e-17 AT3G57570 229 / 2e-65 ARM repeat superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G061800
[exp]
94 / 1e-27 AT3G52105 90 / 1e-25 unknown protein
Potri.001G267501
[exp]
89 / 3e-25 AT3G52105 87 / 9e-25 unknown protein
Potri.016G053400
[exp]
85 / 2e-23 AT3G52105 76 / 9e-20 unknown protein
Potri.006G054200
[exp]
75 / 8e-20 AT3G52105 67 / 2e-16 unknown protein
PFAM info
Representative CDS sequence
>Lus10016415 pacid=23161872 polypeptide=Lus10016415 locus=Lus10016415.g ID=Lus10016415.BGIv1.0 annot-version=v1.0
ATGGCGCTGCAGCTGTTCTTCACGGTGGCTTTCTCAGCCGTGCCTTTGACTCTGTACATTCCGCCGGTGAGGAGCTTGAACATGTTTGTGGAGACGATGG
AGGAAGCCGTCAGAGAATCCAGACTTTACTCAGTTAGGTACTACCCAGCCGCCAGGCAAGTCTGGTCAAGGCTCTGGACCAGATTCCTCCGCCATTTACG
GTTCCTTTGA
AA sequence
>Lus10016415 pacid=23161872 polypeptide=Lus10016415 locus=Lus10016415.g ID=Lus10016415.BGIv1.0 annot-version=v1.0
MALQLFFTVAFSAVPLTLYIPPVRSLNMFVETMEEAVRESRLYSVRYYPAARQVWSRLWTRFLRHLRFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G52105 unknown protein Lus10016415
[exp]
0 1
AT3G09270 ATGSTU8 glutathione S-transferase TAU ... Lus10001491
[exp]
5.7 0.9426
AT4G33950 ATOST1, P44, SR... SNF1-RELATED PROTEIN KINASE 2.... Lus10040179
[exp]
6.2 0.9375
AT2G27510 ATFD3 ferredoxin 3 (.1) Lus10004870
[exp]
10.7 0.9377
AT5G39150 RmlC-like cupins superfamily p... Lus10033767
[exp]
16.1 0.9271
AT5G45230 Disease resistance protein (TI... Lus10012247
[exp]
16.4 0.9268
AT1G22380 ATUGT85A3 UDP-glucosyl transferase 85A3 ... Lus10025741
[exp]
18.4 0.9113
AT1G65520 PEC11, ECHIC, A... "delta\(3\), delta\(2\)-enoyl ... Lus10005158
[exp]
22.8 0.9201
AT5G36160 Tyrosine transaminase family p... Lus10033661
[exp]
23.1 0.9082
AT5G44390 FAD-binding Berberine family p... Lus10001965
[exp]
24.2 0.9226
AT1G70250 receptor serine/threonine kina... Lus10025555
[exp]
24.4 0.9068

Lus10016415 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.