Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019699 [exp] 85 / 9e-24 ND 33 / 0.009 Lus10019700 [exp] 51 / 2e-10 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G055800 [exp] 38 / 2e-05 ND / Potri.006G055900 [exp] 38 / 2e-05 ND / Potri.001G268400 [exp] 37 / 5e-05 ND / Potri.009G062700 [exp] 37 / 5e-05 ND / Potri.006G055500 [exp] 36 / 0.0002 ND / Potri.016G052200 [exp] 35 / 0.0002 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016420 pacid=23161829 polypeptide=Lus10016420 locus=Lus10016420.g ID=Lus10016420.BGIv1.0 annot-version=v1.0 ATGGCAGCCATGCAAGTTAGCAGGTTCAGCGCCTTGGCCGTCCTAGTGATGGTCGCCGTTTGCTCCACCGCCGTATCAGCTCAGGCGCCGGCGCCGTCGC CGGACCAGGGGGCTGGGTTCACCATGGGTGCCTCGGGTGCCATGATTTGTAGCTCTCTGTTGCTTTCCCTGGCTGCTCTGTTGAGGAATTAA
AA sequence Show only first row Show all	>Lus10016420 pacid=23161829 polypeptide=Lus10016420 locus=Lus10016420.g ID=Lus10016420.BGIv1.0 annot-version=v1.0 MAAMQVSRFSALAVLVMVAVCSTAVSAQAPAPSPDQGAGFTMGASGAMICSSLLLSLAALLRN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10016420 [exp]	0	1
AT4G15800		RALFL33	ralf-like 33 (.1)		Lus10000502 [exp]	1.0	0.9736
AT1G75620			glyoxal oxidase-related protei...		Lus10024312 [exp]	3.5	0.9242
AT5G24030		SLAH3	SLAC1 homologue 3 (.1)		Lus10039312 [exp]	4.2	0.8863
AT3G13130			unknown protein		Lus10039066 [exp]	4.6	0.8822
					Lus10042412 [exp]	4.6	0.8368
AT5G44310			Late embryogenesis abundant pr...		Lus10028304 [exp]	4.8	0.8323
AT2G01800			COP1-interacting protein-relat...		Lus10000702 [exp]	4.9	0.8840
AT1G06520		ATGPAT1, GPAT1	glycerol-3-phosphate acyltrans...		Lus10000072 [exp]	5.7	0.8855
AT5G24030		SLAH3	SLAC1 homologue 3 (.1)		Lus10027553 [exp]	6.7	0.8842
AT1G19900			glyoxal oxidase-related protei...		Lus10012387 [exp]	8.4	0.8656

Compare expression of checked genes

Lus10016420 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.