Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G36240 203 / 2e-69 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) AT1G77940 199 / 7e-68 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) AT3G18740 199 / 1e-67 RLK902 receptor-like kinase 902, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016432 [exp] 229 / 2e-79 AT1G36240 202 / 4e-69 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10019682 [exp] 225 / 5e-78 AT1G36240 199 / 1e-67 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10019681 [exp] 224 / 8e-78 AT1G36240 201 / 2e-68 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10027926 [exp] 173 / 1e-57 AT1G77940 160 / 1e-52 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10012057 [exp] 157 / 4e-51 AT1G77940 145 / 2e-46 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G086800 [exp] 215 / 3e-74 AT1G77940 207 / 6e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.005G080700 [exp] 214 / 6e-74 AT1G77940 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.004G196500 [exp] 214 / 1e-73 AT1G36240 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.009G158700 [exp] 214 / 1e-73 AT1G36240 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0101 [flax] [poplar] PELOTA PF01248 [flax] [poplar] Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence Show only first row Show all	>Lus10016431 pacid=23161820 polypeptide=Lus10016431 locus=Lus10016431.g ID=Lus10016431.BGIv1.0 annot-version=v1.0 ATGGTGGCGGCTAAGAAAACAAAAAAGACTCATGAGAGCATCAACAATAGGCTTGCTCTGGTGATGAAGAGCGGCAAGTACAGCCTTGGGTACAAAACCG TCCTCCGCAATCTGAGAAGCTCCAAAGGGAAATTGATCATAATCTCGAACAACTGTCCTCCTTTGAGGAAGTCTGAGATTGAGTACTACGCCATGCTTGC CAAGGTCGGGGTTCACCATTACACTGGAAACAACGTTGAATTGGGCACTGCCTGTGGGAAATACTTCCGTGTCTCGTGCCTGAGCATCATCGATGCAGGC GACTCTGACATCATCAAGTCCCTACCTGGTGATCACTGA
AA sequence Show only first row Show all	>Lus10016431 pacid=23161820 polypeptide=Lus10016431 locus=Lus10016431.g ID=Lus10016431.BGIv1.0 annot-version=v1.0 MVAAKKTKKTHESINNRLALVMKSGKYSLGYKTVLRNLRSSKGKLIIISNNCPPLRKSEIEYYAMLAKVGVHHYTGNNVELGTACGKYFRVSCLSIIDAG DSDIIKSLPGDH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G36240			Ribosomal protein L7Ae/L30e/S1...		Lus10016431 [exp]	0	1
AT5G28060			Ribosomal protein S24e family ...		Lus10004123 [exp]	1.0	0.9162
AT5G10360		RPS6B, EMB3010	Ribosomal protein small subuni...		Lus10007376 [exp]	2.4	0.8925
AT3G05560			Ribosomal L22e protein family ...		Lus10006509 [exp]	3.5	0.8869
AT2G19740			Ribosomal protein L31e family ...		Lus10018032 [exp]	5.9	0.8752
AT1G64880			Ribosomal protein S5 family pr...		Lus10034602 [exp]	6.0	0.8526
AT4G18100			Ribosomal protein L32e (.1)		Lus10004589 [exp]	6.0	0.8672
AT3G13580			Ribosomal protein L30/L7 famil...		Lus10016970 [exp]	7.2	0.8777
AT3G22660			rRNA processing protein-relate...		Lus10031120 [exp]	7.5	0.8652
AT2G03510			SPFH/Band 7/PHB domain-contain...		Lus10004648 [exp]	7.7	0.8572
AT3G12150			unknown protein		Lus10035501 [exp]	9.0	0.8596

Compare expression of checked genes

Lus10016431 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.