Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G36240 203 / 2e-69 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) AT1G77940 199 / 7e-68 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) AT3G18740 199 / 1e-67 RLK902 receptor-like kinase 902, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016431 [exp] 229 / 2e-79 AT1G36240 202 / 4e-69 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10019682 [exp] 225 / 5e-78 AT1G36240 199 / 1e-67 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10019681 [exp] 224 / 8e-78 AT1G36240 201 / 2e-68 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10027926 [exp] 173 / 1e-57 AT1G77940 160 / 1e-52 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10012057 [exp] 157 / 4e-51 AT1G77940 145 / 2e-46 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G086800 [exp] 215 / 3e-74 AT1G77940 207 / 6e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.005G080700 [exp] 214 / 6e-74 AT1G77940 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.004G196500 [exp] 214 / 1e-73 AT1G36240 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Potri.009G158700 [exp] 214 / 1e-73 AT1G36240 208 / 2e-71 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0101 [flax] [poplar] PELOTA PF01248 [flax] [poplar] Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence Show only first row Show all	>Lus10016432 pacid=23161836 polypeptide=Lus10016432 locus=Lus10016432.g ID=Lus10016432.BGIv1.0 annot-version=v1.0 ATGGTGGCCGCTAAGAAAACAAAAAAGACTCATGAGAGCATCAACAACAGGCTTGCTCTTGTGATGAAGAGCGGAAAGTACAGCCTTGGGTACAAAACCG TGCTCCGCAATCTGAGAAGCTCCAAAGGGAAATTGATCATAATCTCTAACAATTGCCCTCCTTTGAGGAAGTCTGAGATTGAGTACTATGCCATGCTTGC CAAGGTCGGGGTTCACCATTACACTGGAAACAACGTTGAATTGGGCACTGCCTGCGGGAAATACTTCCGTGTTTCTTGCTTGAGCATCATCGATGCAGGT GACTCTGACATCATCAAGTCCCTACCCGGTGATCACTGA
AA sequence Show only first row Show all	>Lus10016432 pacid=23161836 polypeptide=Lus10016432 locus=Lus10016432.g ID=Lus10016432.BGIv1.0 annot-version=v1.0 MVAAKKTKKTHESINNRLALVMKSGKYSLGYKTVLRNLRSSKGKLIIISNNCPPLRKSEIEYYAMLAKVGVHHYTGNNVELGTACGKYFRVSCLSIIDAG DSDIIKSLPGDH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G36240			Ribosomal protein L7Ae/L30e/S1...		Lus10016432 [exp]	0	1
AT5G02610			Ribosomal L29 family protein ...		Lus10025292 [exp]	1.0	0.9195
AT1G17880		ATBTF3	basic transcription factor 3 (...		Lus10031551 [exp]	1.7	0.8971
AT5G23740		RPS11-BETA	ribosomal protein S11-beta (.1...		Lus10041029 [exp]	3.5	0.9045
AT1G03150			Acyl-CoA N-acyltransferases (N...		Lus10042595 [exp]	5.5	0.8389
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Lus10006914 [exp]	6.7	0.8861
AT4G34670			Ribosomal protein S3Ae (.1)		Lus10006609 [exp]	7.5	0.8885
AT1G20370			Pseudouridine synthase family ...		Lus10005641 [exp]	7.5	0.8630
AT3G62870			Ribosomal protein L7Ae/L30e/S1...		Lus10010745 [exp]	7.7	0.8681
AT1G64350		SEH1H	Transducin/WD40 repeat-like su...		Lus10001904 [exp]	7.9	0.8570
AT3G16780			Ribosomal protein L19e family ...		Lus10023388 [exp]	9.8	0.8186

Compare expression of checked genes

Lus10016432 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.