Lus10016449 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G52370 155 / 2e-49 unknown protein
AT5G58990 149 / 7e-47 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040713 235 / 2e-80 AT5G52370 167 / 6e-54 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G040100 167 / 7e-54 AT5G52370 150 / 4e-47 unknown protein
Potri.001G246800 163 / 5e-52 AT5G52370 160 / 2e-51 unknown protein
PFAM info
Representative CDS sequence
>Lus10016449 pacid=23144843 polypeptide=Lus10016449 locus=Lus10016449.g ID=Lus10016449.BGIv1.0 annot-version=v1.0
ATGGCGACTAGTTTGGCGAACAGAGCATCTTCCACTAATCAAGTCCTATGTTTCTTCCGATGCGGTTTGAATTCAATCAGAAACTTGAGCACTTCTTCTA
CTCCGGCTCCAGCTCAAGCCCCATCTTCCGACTCACCTGCCAAGAAATCGAAGCGGCGGAAGAAGAAGAACCTCTTCGAGGTTGCTCAGTTCTTGCCCAA
ATGGGGACTGGGATACCACTTGGCCAAATCTCACTGGTCCAATGTCTCCTACGAGATCACCAAGATCAATCTCTACAAGGATGGTAGACACGGGAAGGCA
TGGGGGCTTGCTTACAAAGACGGATTACCTGCAGCAGATGCTCCCAAGAAGATCAGCGGAGTTCATAAGCGTTGCTGGAAATATCTACCGGGCTTAGAAA
AATCAAATCAGAACTTGCTAAAGTCCCCAAGTCCAACAGAGACCACTGCTCCTCAGGCTGAACAAGTTGAAGCTGCCTAA
AA sequence
>Lus10016449 pacid=23144843 polypeptide=Lus10016449 locus=Lus10016449.g ID=Lus10016449.BGIv1.0 annot-version=v1.0
MATSLANRASSTNQVLCFFRCGLNSIRNLSTSSTPAPAQAPSSDSPAKKSKRRKKKNLFEVAQFLPKWGLGYHLAKSHWSNVSYEITKINLYKDGRHGKA
WGLAYKDGLPAADAPKKISGVHKRCWKYLPGLEKSNQNLLKSPSPTETTAPQAEQVEAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G52370 unknown protein Lus10016449 0 1
AT5G27850 Ribosomal protein L18e/L15 sup... Lus10041264 3.5 0.9477
AT2G44120 Ribosomal protein L30/L7 famil... Lus10004220 5.7 0.9490
AT5G47680 AtTRM, TRM10 tRNA modification 10, unknown ... Lus10038778 6.0 0.9326
AT4G16720 Ribosomal protein L23/L15e fam... Lus10000165 8.1 0.9313
AT2G03590 ATUPS1 ureide permease 1 (.1) Lus10037074 8.3 0.9356
AT1G60770 Tetratricopeptide repeat (TPR)... Lus10029115 10.0 0.9115
AT5G09510 Ribosomal protein S19 family p... Lus10033856 11.1 0.9350
AT3G06700 Ribosomal L29e protein family ... Lus10016875 12.2 0.9349
AT1G34030 Ribosomal protein S13/S18 fami... Lus10034179 13.2 0.9037
AT4G18100 Ribosomal protein L32e (.1) Lus10011970 14.2 0.9339

Lus10016449 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.