Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29540 131 / 5e-41 ATRPAC14, ATRPC14 RNApolymerase 14 kDa subunit (.1.2.3) AT3G52090 57 / 1e-11 NRPE11, NRPD11, NRPB11, ATRPB13.6 DNA-directed RNA polymerase, RBP11-like (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040717 [exp] 219 / 8e-76 AT2G29540 132 / 3e-41 RNApolymerase 14 kDa subunit (.1.2.3) Lus10019715 [exp] 55 / 9e-10 AT3G08020 726 / 0.0 PHD finger family protein (.1) Lus10016404 [exp] 54 / 1e-09 AT3G08020 569 / 0.0 PHD finger family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G246600 [exp] 165 / 1e-54 AT2G29540 136 / 6e-43 RNApolymerase 14 kDa subunit (.1.2.3) Potri.009G070900 [exp] 54 / 2e-10 AT3G52090 219 / 2e-75 DNA-directed RNA polymerase, RBP11-like (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0509 [flax] [poplar] RBP11-like PF01193 [flax] [poplar] RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
Representative CDS sequence Show only first row Show all	>Lus10016452 pacid=23144877 polypeptide=Lus10016452 locus=Lus10016452.g ID=Lus10016452.BGIv1.0 annot-version=v1.0 ATGGAGCACGGCTCTTTGAACGATCCAAGCAAGGCTACCTTCACTTTTGTTGACGAGGACCACACGCTTGCAAATGCTGTCAGATTCAGCTTGAATCAAG ATCCAAGGGTGTCATTCTGTGGATACAGCATACCTCATCCTTCTGATGCTCGAGTTAACATTAGAATCCAGACTACAGGTGCACCTGCACGAGAGGTATT GAAGGATGGATGTGACTATTTGATGCGAATGTGCCAGCATGTAAATAACACTGTGGACAAGGCTGTTGCCGAATTTAGAGCGAAGAATTCCGCAGAGATG GAAACAGACAGTGGTTCAAATTGA
AA sequence Show only first row Show all	>Lus10016452 pacid=23144877 polypeptide=Lus10016452 locus=Lus10016452.g ID=Lus10016452.BGIv1.0 annot-version=v1.0 MEHGSLNDPSKATFTFVDEDHTLANAVRFSLNQDPRVSFCGYSIPHPSDARVNIRIQTTGAPAREVLKDGCDYLMRMCQHVNNTVDKAVAEFRAKNSAEM ETDSGSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G29540		ATRPAC14, ATRPC...	RNApolymerase 14 kDa subunit (...		Lus10016452 [exp]	0	1
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10038195 [exp]	2.0	0.7535
AT3G09890			Ankyrin repeat family protein ...		Lus10023911 [exp]	4.7	0.7393
AT4G15720			Tetratricopeptide repeat (TPR)...		Lus10037505 [exp]	15.2	0.7106
AT2G02880			mucin-related (.1)		Lus10030486 [exp]	16.4	0.7322
AT5G04280		AtRZ-1c	AtRZ-1c, RNA-binding (RRM/RBD/...		Lus10000128 [exp]	17.0	0.6766
AT3G26922			F-box/RNI-like superfamily pro...		Lus10016192 [exp]	20.5	0.6793
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10033806 [exp]	24.0	0.7187
AT3G10572		APEM9	ABERRANT PEROXISOME MORPHOLOGY...		Lus10021597 [exp]	30.0	0.7278
AT4G00420			Double-stranded RNA-binding do...		Lus10024106 [exp]	34.8	0.7053
AT1G27695			glycine-rich protein (.1.2)		Lus10032855 [exp]	37.7	0.7223

Compare expression of checked genes

Lus10016452 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.