Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G29530 145 / 4e-47 TIM10 Tim10/DDP family zinc finger protein (.1.2.3) AT3G46560 37 / 0.0003 TIM9, EMB2474 embryo defective 2474, Tim10/DDP family zinc finger protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040718 [exp] 173 / 4e-58 AT2G29530 146 / 1e-47 Tim10/DDP family zinc finger protein (.1.2.3) Lus10017463 [exp] 40 / 1e-05 AT3G46560 156 / 2e-51 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10017352 [exp] 38 / 0.0001 AT1G61570 92 / 6e-26 translocase of the inner mitochondrial membrane 13 (.1) Lus10037964 [exp] 37 / 0.0003 AT3G46560 163 / 3e-54 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10038695 [exp] 37 / 0.0003 AT3G46560 163 / 3e-54 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10028819 [exp] 36 / 0.0004 AT3G46560 110 / 1e-33 embryo defective 2474, Tim10/DDP family zinc finger protein (.1) Lus10010147 [exp] 37 / 0.0006 AT2G18196 165 / 5e-52 Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G039600 [exp] 158 / 2e-52 AT2G29530 141 / 1e-45 Tim10/DDP family zinc finger protein (.1.2.3) Potri.001G246500 [exp] 155 / 3e-51 AT2G29530 139 / 6e-45 Tim10/DDP family zinc finger protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02953 [flax] [poplar] zf-Tim10_DDP Tim10/DDP family zinc finger
Representative CDS sequence Show only first row Show all	>Lus10016453 pacid=23144807 polypeptide=Lus10016453 locus=Lus10016453.g ID=Lus10016453.BGIv1.0 annot-version=v1.0 ATGGCTGCCAGCAATACCGGACTCCCTGCAGGCGTCACCAAAGAACAGGCCTTTGGCATGGCAGAGACTGAGATGGAGTACAGAGTAGAGTTGTTCAACA GGCTCGGTCAGACTTGTTTCAACAAGTGTGTTGACAAAAGGTACAAGGAATCTGAGCTCAACATGGGTGAAAACAGCTGCATCGATCGCTGCGTTTCAAA ATATTGGCTGGTGAACGGTCTGGTAGGTCAGATGCTGAGCGCCGGTGGTCAGCGCCCCATGTGA
AA sequence Show only first row Show all	>Lus10016453 pacid=23144807 polypeptide=Lus10016453 locus=Lus10016453.g ID=Lus10016453.BGIv1.0 annot-version=v1.0 MAASNTGLPAGVTKEQAFGMAETEMEYRVELFNRLGQTCFNKCVDKRYKESELNMGENSCIDRCVSKYWLVNGLVGQMLSAGGQRPM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G29530		TIM10	Tim10/DDP family zinc finger p...		Lus10016453 [exp]	0	1
AT2G29530		TIM10	Tim10/DDP family zinc finger p...		Lus10040718 [exp]	1.4	0.9066
AT5G27700			Ribosomal protein S21e (.1)		Lus10031494 [exp]	2.2	0.9087
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Lus10021027 [exp]	3.0	0.8972
AT4G25740			RNA binding Plectin/S10 domain...		Lus10039282 [exp]	11.3	0.8612
AT3G56070		ROC2	rotamase cyclophilin 2 (.1.2)		Lus10042553 [exp]	14.8	0.8521
AT2G44860			Ribosomal protein L24e family ...		Lus10009403 [exp]	18.5	0.8350
AT3G51800		ATEBP1, ATG2, E...	A. THALIANA ERBB-3 BINDING PRO...		Lus10002851 [exp]	22.6	0.8894
AT2G44120			Ribosomal protein L30/L7 famil...		Lus10029423 [exp]	23.1	0.8880
AT5G60670			Ribosomal protein L11 family p...		Lus10015085 [exp]	23.2	0.8283
AT1G26880			Ribosomal protein L34e superfa...		Lus10030477 [exp]	23.7	0.8820

Compare expression of checked genes

Lus10016453 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.