Lus10016457 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G29500 176 / 2e-57 HSP20-like chaperones superfamily protein (.1)
AT5G59720 164 / 1e-52 HSP18.2 HSP18.1CI heat shock protein 18.2 (.1)
AT1G07400 163 / 3e-52 HSP20-like chaperones superfamily protein (.1)
AT3G46230 162 / 7e-52 ATHSP17.4 ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.4, heat shock protein 17.4 (.1)
AT1G53540 158 / 3e-50 HSP20-like chaperones superfamily protein (.1)
AT1G59860 152 / 8e-48 HSP20-like chaperones superfamily protein (.1)
AT4G10250 100 / 3e-27 ATHSP22.0 HSP20-like chaperones superfamily protein (.1)
AT5G12020 71 / 4e-16 HSP17.6II 17.6 kDa class II heat shock protein (.1)
AT5G12030 70 / 1e-15 AT-HSP17.6A heat shock protein 17.6A (.1)
AT5G37670 69 / 2e-15 HSP15.7CI HSP20-like chaperones superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040722 229 / 3e-78 AT1G07400 214 / 2e-72 HSP20-like chaperones superfamily protein (.1)
Lus10016456 226 / 9e-77 AT1G07400 213 / 8e-72 HSP20-like chaperones superfamily protein (.1)
Lus10040723 221 / 6e-75 AT2G29500 219 / 3e-74 HSP20-like chaperones superfamily protein (.1)
Lus10016458 203 / 1e-67 AT2G29500 214 / 3e-72 HSP20-like chaperones superfamily protein (.1)
Lus10009085 164 / 2e-52 AT1G53540 232 / 2e-79 HSP20-like chaperones superfamily protein (.1)
Lus10040830 141 / 1e-43 AT1G53540 236 / 6e-81 HSP20-like chaperones superfamily protein (.1)
Lus10040560 99 / 4e-26 AT4G10250 200 / 1e-65 HSP20-like chaperones superfamily protein (.1)
Lus10000932 98 / 8e-26 AT4G10250 200 / 2e-65 HSP20-like chaperones superfamily protein (.1)
Lus10026262 93 / 5e-24 AT4G10250 152 / 5e-47 HSP20-like chaperones superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G187450 189 / 2e-62 AT2G29500 221 / 5e-75 HSP20-like chaperones superfamily protein (.1)
Potri.009G039200 189 / 3e-62 AT1G07400 201 / 3e-67 HSP20-like chaperones superfamily protein (.1)
Potri.009G147900 188 / 5e-62 AT2G29500 193 / 5e-64 HSP20-like chaperones superfamily protein (.1)
Potri.004G187202 187 / 2e-61 AT2G29500 209 / 1e-70 HSP20-like chaperones superfamily protein (.1)
Potri.009G148000 183 / 5e-60 AT2G29500 190 / 7e-63 HSP20-like chaperones superfamily protein (.1)
Potri.004G187400 181 / 2e-59 AT1G07400 193 / 7e-64 HSP20-like chaperones superfamily protein (.1)
Potri.019G081200 181 / 4e-59 AT2G29500 186 / 3e-61 HSP20-like chaperones superfamily protein (.1)
Potri.019G081250 176 / 2e-57 AT2G29500 182 / 6e-60 HSP20-like chaperones superfamily protein (.1)
Potri.001G238700 175 / 5e-57 AT1G53540 195 / 8e-65 HSP20-like chaperones superfamily protein (.1)
Potri.009G049800 173 / 3e-56 AT2G29500 152 / 4e-48 HSP20-like chaperones superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0190 HSP20 PF00011 HSP20 Hsp20/alpha crystallin family
Representative CDS sequence
>Lus10016457 pacid=23144834 polypeptide=Lus10016457 locus=Lus10016457.g ID=Lus10016457.BGIv1.0 annot-version=v1.0
ATGTCGCTGATTCCAAGCTTCTTCGGTAACCGCCGATCCGACCCCTTCTCCGCCCTGGATATGTGGGATCCGTTTAGGGATTTCTCATCCTTCAACTTCC
CTTCGTCCTCTTCTCTGATCCTCGGGCGCGGGGAGAACTCTGCTTTCGTGAACACGCGGATCGACTGGAAGGAGACTCCAGAGGCGCACGTGTTCAAGGC
GGACCTCCCGGGGCTGAAGAAGGAGGAGGTTAAGGTCGAGGTGGAGGAAGATCGGGTGCTGCAGATCAGCGGGGAGAGGAACGTGGAGAAGGAGGATAAG
AACGACACGTGGCACAGGGTTGAGAGGAGCAGCGGGAAGTTCATGAGGAGGTTCAGACTCCCGGAGAATGCTAAGATGGAGGAGGTTAAGGCGGCGATGG
AGAACGGCGTGCTGACGGTGACGGTTCCCAAGGCGGAGGTGAAGAAGCCTGAAGTCAAGGCCATCGAGATATCTGGTTAG
AA sequence
>Lus10016457 pacid=23144834 polypeptide=Lus10016457 locus=Lus10016457.g ID=Lus10016457.BGIv1.0 annot-version=v1.0
MSLIPSFFGNRRSDPFSALDMWDPFRDFSSFNFPSSSSLILGRGENSAFVNTRIDWKETPEAHVFKADLPGLKKEEVKVEVEEDRVLQISGERNVEKEDK
NDTWHRVERSSGKFMRRFRLPENAKMEEVKAAMENGVLTVTVPKAEVKKPEVKAIEISG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G07400 HSP20-like chaperones superfam... Lus10016457 0 1
AT1G05010 ACO4, EAT1, EFE ethylene forming enzyme, ethyl... Lus10029992 1.7 0.9114
AT4G15415 ATB'GAMMA, ATB'... Protein phosphatase 2A regulat... Lus10025085 2.8 0.9103
AT4G14380 unknown protein Lus10011818 6.0 0.8569
AT1G12310 Calcium-binding EF-hand family... Lus10004332 6.0 0.8842
AT3G07470 Protein of unknown function, D... Lus10039620 6.8 0.8470
AT3G43270 Plant invertase/pectin methyle... Lus10010170 6.9 0.8714
AT1G70250 receptor serine/threonine kina... Lus10032228 8.1 0.8634
AT1G04560 AWPM-19-like family protein (.... Lus10014456 8.1 0.8483
Lus10026314 9.4 0.8649
AT1G67570 Protein of unknown function (D... Lus10043011 9.5 0.8601

Lus10016457 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.