Lus10016462 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59030 76 / 2e-19 COPT1 copper transporter 1 (.1)
AT3G46900 69 / 1e-16 COPT2 copper transporter 2 (.1)
AT5G59040 67 / 4e-16 COPT3 copper transporter 3 (.1)
AT2G26975 66 / 1e-15 Ctr copper transporter family (.1)
AT2G37925 63 / 2e-14 COPT4 copper transporter 4 (.1)
AT5G20650 42 / 3e-06 COPT5 copper transporter 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040726 119 / 3e-36 AT2G26975 138 / 2e-42 Ctr copper transporter family (.1)
Lus10016464 73 / 6e-18 AT5G59030 151 / 1e-47 copper transporter 1 (.1)
Lus10021108 71 / 2e-17 AT2G37925 120 / 2e-35 copper transporter 4 (.1)
Lus10017204 68 / 9e-17 AT5G59030 88 / 3e-23 copper transporter 1 (.1)
Lus10021107 50 / 3e-09 AT5G59040 87 / 1e-22 copper transporter 3 (.1)
Lus10017205 50 / 3e-09 AT2G26975 87 / 2e-22 Ctr copper transporter family (.1)
Lus10032428 49 / 6e-09 AT2G26975 87 / 1e-22 Ctr copper transporter family (.1)
Lus10023045 46 / 1e-07 AT2G26975 84 / 2e-21 Ctr copper transporter family (.1)
Lus10007092 44 / 3e-07 AT5G20650 169 / 6e-55 copper transporter 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G038800 84 / 2e-22 AT5G59030 148 / 4e-46 copper transporter 1 (.1)
Potri.001G246000 79 / 1e-20 AT5G59030 134 / 9e-41 copper transporter 1 (.1)
Potri.009G038700 79 / 2e-20 AT2G26975 133 / 2e-40 Ctr copper transporter family (.1)
Potri.006G093300 66 / 2e-15 AT2G37925 114 / 3e-33 copper transporter 4 (.1)
Potri.006G093200 55 / 3e-11 AT3G46900 89 / 6e-23 copper transporter 2 (.1)
Potri.006G219200 47 / 4e-08 AT5G20650 140 / 1e-43 copper transporter 5 (.1)
Potri.006G140700 44 / 6e-07 AT5G20650 151 / 7e-48 copper transporter 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04145 Ctr Ctr copper transporter family
Representative CDS sequence
>Lus10016462 pacid=23144782 polypeptide=Lus10016462 locus=Lus10016462.g ID=Lus10016462.BGIv1.0 annot-version=v1.0
ATGTACACGGTCAGGGTGGGACTCGCGTATATGGTGATGCTGGCGCTGATGTCGTTCAACGGCGGAGTGTTTTTGGCGGCGGTGGCGGGTCACGCTTTGG
GGTTTTTGGTGTTCGGGAGTAAGGTTTTCGAGAAGGATGAGGTGGATAGAGAGTCGGAGGATTGCCGGGATCTGCCTCCGATGAGATGTTGA
AA sequence
>Lus10016462 pacid=23144782 polypeptide=Lus10016462 locus=Lus10016462.g ID=Lus10016462.BGIv1.0 annot-version=v1.0
MYTVRVGLAYMVMLALMSFNGGVFLAAVAGHALGFLVFGSKVFEKDEVDRESEDCRDLPPMRC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G59030 COPT1 copper transporter 1 (.1) Lus10016462 0 1
AT2G26975 Ctr copper transporter family ... Lus10016463 1.0 0.8801
AT1G51700 DOF ADOF1, AtDof1. ... DOF zinc finger protein 1 (.1) Lus10035504 17.9 0.8498
AT4G21970 Protein of unknown function, D... Lus10021536 18.2 0.8618
AT4G14680 APS3 Pseudouridine synthase/archaeo... Lus10039389 26.6 0.8552
AT4G29810 MK1, ATMKK2 MAP KINASE KINASE 1, MAP kinas... Lus10011945 32.5 0.8241
AT4G31180 Class II aminoacyl-tRNA and bi... Lus10028555 33.2 0.8604
AT4G30340 ATDGK7 diacylglycerol kinase 7 (.1) Lus10019987 48.2 0.8331
AT4G23030 MATE efflux family protein (.1... Lus10017836 96.3 0.8058
AT1G73880 UGT89B1 UDP-glucosyl transferase 89B1 ... Lus10013500 98.5 0.8276
AT3G22890 APS1 ATP sulfurylase 1 (.1) Lus10006629 156.6 0.8057

Lus10016462 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.