Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26975 74 / 8e-18 Ctr copper transporter family (.1) AT5G59030 68 / 2e-15 COPT1 copper transporter 1 (.1) AT2G37925 65 / 2e-14 COPT4 copper transporter 4 (.1) AT5G59040 62 / 3e-13 COPT3 copper transporter 3 (.1) AT3G46900 59 / 5e-12 COPT2 copper transporter 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040726 [exp] 145 / 7e-46 AT2G26975 138 / 2e-42 Ctr copper transporter family (.1) Lus10016464 [exp] 74 / 7e-18 AT5G59030 151 / 1e-47 copper transporter 1 (.1) Lus10021108 [exp] 72 / 8e-17 AT2G37925 120 / 2e-35 copper transporter 4 (.1) Lus10017205 [exp] 45 / 9e-07 AT2G26975 87 / 2e-22 Ctr copper transporter family (.1) Lus10021107 [exp] 42 / 7e-06 AT5G59040 87 / 1e-22 copper transporter 3 (.1) Lus10017204 [exp] 40 / 3e-05 AT5G59030 88 / 3e-23 copper transporter 1 (.1) Lus10009819 [exp] 37 / 0.0006 AT5G20650 147 / 5e-46 copper transporter 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G038700 [exp] 86 / 2e-22 AT2G26975 133 / 2e-40 Ctr copper transporter family (.1) Potri.006G093300 [exp] 76 / 6e-19 AT2G37925 114 / 3e-33 copper transporter 4 (.1) Potri.006G093200 [exp] 63 / 1e-13 AT3G46900 89 / 6e-23 copper transporter 2 (.1) Potri.001G246000 [exp] 62 / 3e-13 AT5G59030 134 / 9e-41 copper transporter 1 (.1) Potri.009G038800 [exp] 62 / 5e-13 AT5G59030 148 / 4e-46 copper transporter 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04145 [flax] [poplar] Ctr Ctr copper transporter family
Representative CDS sequence Show only first row Show all	>Lus10016463 pacid=23144880 polypeptide=Lus10016463 locus=Lus10016463.g ID=Lus10016463.BGIv1.0 annot-version=v1.0 ATGCCCCCCAACATGGACATGACCGGCGGCGGCGGCGGCGGAGGAATGAACGTCACCCACCAACGGAAGATGATGATGCACATGACCTTCTACTGGGGAT CGGAGGCCCTGATTCTATTCAAGGGATGGCCGGGGACCCAACCGGGGTTGTACGCTCTGTCCCTGGTGGTGGTCTTCGCTCTGGCGTTTCTCGTGGAGTG GCTGTCGGGTTCTCGGTTGATCCGGAAGGGGACGGGTCGGGTGGCGGCCGGGTTGATCCGGACGGCGATGTATACGGTCAGGGTGGGACTCGTCGGTCCA ATTGTTATCCACCTTGTATAG
AA sequence Show only first row Show all	>Lus10016463 pacid=23144880 polypeptide=Lus10016463 locus=Lus10016463.g ID=Lus10016463.BGIv1.0 annot-version=v1.0 MPPNMDMTGGGGGGGMNVTHQRKMMMHMTFYWGSEALILFKGWPGTQPGLYALSLVVVFALAFLVEWLSGSRLIRKGTGRVAAGLIRTAMYTVRVGLVGP IVIHLV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G26975			Ctr copper transporter family ...		Lus10016463 [exp]	0	1
AT5G59030		COPT1	copper transporter 1 (.1)		Lus10016462 [exp]	1.0	0.8801
AT3G19615			unknown protein		Lus10042265 [exp]	21.9	0.8663
AT1G76360			Protein kinase superfamily pro...		Lus10013223 [exp]	24.7	0.8455
AT2G32190			unknown protein		Lus10010460 [exp]	28.2	0.8438
AT5G47790	FHA		SMAD/FHA domain-containing pro...		Lus10003911 [exp]	78.7	0.8184
AT1G21450	GRAS	SCL1	SCARECROW-like 1 (.1)		Lus10042776 [exp]	100.0	0.7837
AT4G21540		SPHK1	sphingosine kinase 1 (.1.2.3)		Lus10011246 [exp]	110.5	0.8031
AT2G31880		SOBIR1, EVR	SUPPRESSOR OF BIR1 1, EVERSHED...		Lus10041953 [exp]	113.9	0.7915
AT1G55915			zinc ion binding (.1)		Lus10035762 [exp]	115.7	0.7630
					Lus10009514 [exp]	116.9	0.8091

Compare expression of checked genes

Lus10016463 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.