Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41685 81 / 8e-22 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) AT1G64220 78 / 1e-20 TOM7-2 translocase of outer membrane 7 kDa subunit 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000059 [exp] 103 / 5e-31 AT5G41685 89 / 5e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10040758 [exp] 103 / 9e-31 AT5G41685 88 / 7e-25 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10001641 [exp] 92 / 2e-26 AT5G41685 85 / 1e-23 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10007843 [exp] 89 / 3e-25 AT5G41685 85 / 5e-24 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Lus10004754 [exp] 86 / 4e-24 AT5G41685 81 / 3e-22 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G146602 [exp] 76 / 3e-20 AT5G41685 78 / 9e-21 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Potri.006G077500 [exp] 76 / 7e-20 AT5G41685 75 / 1e-19 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1) Potri.018G145502 [exp] 72 / 1e-18 AT5G41685 74 / 2e-19 Mitochondrial outer membrane translocase complex, subunit Tom7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08038 [flax] [poplar] Tom7 TOM7 family
Representative CDS sequence Show only first row Show all	>Lus10016473 pacid=23144896 polypeptide=Lus10016473 locus=Lus10016473.g ID=Lus10016473.BGIv1.0 annot-version=v1.0 ATGGCGTCTAGGGTTTCGCTGAGGACGAAAGGGTCGAAGAGCAGCAAGAAAGGCAAACGCAGTGACGAGAAATCGAGGACGGAGAGCTTGAAGGAGTGGA CAGATTGGAGCTTGCACAAGGCCAAAGTCGCCGTTCACTATGGCTTCATCCCTCTCATCATTTACATCGGCATGAACTCTGAACCAAAACCTCAGCTGTA CCAGCTCCTCAGCCCCGTCTGA
AA sequence Show only first row Show all	>Lus10016473 pacid=23144896 polypeptide=Lus10016473 locus=Lus10016473.g ID=Lus10016473.BGIv1.0 annot-version=v1.0 MASRVSLRTKGSKSSKKGKRSDEKSRTESLKEWTDWSLHKAKVAVHYGFIPLIIYIGMNSEPKPQLYQLLSPV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G41685			Mitochondrial outer membrane t...		Lus10016473 [exp]	0	1
AT1G31817		NFD3	NUCLEAR FUSION DEFECTIVE 3, Ri...		Lus10012155 [exp]	1.0	0.8737
AT1G61570		TIM13	translocase of the inner mitoc...		Lus10017352 [exp]	7.1	0.7979
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10043405 [exp]	9.8	0.7825
AT3G26360			Ribosomal protein S21 family p...		Lus10006466 [exp]	9.8	0.7340
AT1G47278			unknown protein		Lus10016567 [exp]	9.9	0.7535
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Lus10012464 [exp]	11.0	0.7686
AT4G30220		RUXF	small nuclear ribonucleoprotei...		Lus10006867 [exp]	15.0	0.7805
AT5G24840			tRNA (guanine-N-7) methyltrans...		Lus10026965 [exp]	15.8	0.7506
AT2G03510			SPFH/Band 7/PHB domain-contain...		Lus10004648 [exp]	16.1	0.7617
AT1G71730			unknown protein		Lus10042772 [exp]	16.7	0.7265

Compare expression of checked genes

Lus10016473 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.