Lus10016483 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G58840 120 / 2e-32 Subtilase family protein (.1)
AT5G59110 108 / 1e-30 subtilisin-like serine protease-related (.1)
AT5G59090 114 / 3e-30 ATSBT4.12 subtilase 4.12 (.1.2.3)
AT5G59130 112 / 1e-29 Subtilase family protein (.1.2)
AT5G58830 111 / 4e-29 Subtilisin-like serine endopeptidase family protein (.1)
AT3G46850 109 / 2e-28 Subtilase family protein (.1)
AT5G59120 109 / 2e-28 ATSBT4.13 subtilase 4.13 (.1)
AT3G46840 108 / 3e-28 Subtilase family protein (.1)
AT5G59100 108 / 3e-28 Subtilisin-like serine endopeptidase family protein (.1)
AT5G58820 102 / 4e-26 Subtilisin-like serine endopeptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040751 206 / 1e-62 AT5G59100 632 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
Lus10016484 199 / 6e-61 AT5G59100 672 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
Lus10040750 187 / 2e-56 AT5G59120 714 / 0.0 subtilase 4.13 (.1)
Lus10016482 179 / 2e-53 AT3G46850 709 / 0.0 Subtilase family protein (.1)
Lus10004685 91 / 1e-21 AT4G00230 647 / 0.0 xylem serine peptidase 1 (.1)
Lus10009867 90 / 2e-21 AT5G59190 629 / 0.0 subtilase family protein (.1)
Lus10040253 90 / 2e-21 AT5G59090 640 / 0.0 subtilase 4.12 (.1.2.3)
Lus10004681 89 / 2e-21 AT5G59100 257 / 2e-79 Subtilisin-like serine endopeptidase family protein (.1)
Lus10004683 89 / 5e-21 AT5G59190 600 / 0.0 subtilase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G038001 116 / 5e-31 AT3G46850 794 / 0.0 Subtilase family protein (.1)
Potri.009G037900 96 / 1e-23 AT5G59100 777 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
Potri.010G196700 89 / 2e-21 AT5G59100 579 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
Potri.003G071800 86 / 3e-20 AT3G14240 1199 / 0.0 Subtilase family protein (.1)
Potri.010G196800 86 / 4e-20 AT5G59100 599 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
Potri.001G163600 85 / 5e-20 AT3G14240 1174 / 0.0 Subtilase family protein (.1)
Potri.010G196900 82 / 8e-19 AT5G59100 657 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
Potri.001G455800 78 / 2e-17 AT4G10550 558 / 0.0 Subtilase family protein (.1.2.3)
Potri.014G171600 77 / 3e-17 AT2G04160 986 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1)
Potri.011G146300 77 / 4e-17 AT4G10550 546 / 0.0 Subtilase family protein (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10016483 pacid=23144813 polypeptide=Lus10016483 locus=Lus10016483.g ID=Lus10016483.BGIv1.0 annot-version=v1.0
ATGACGGGCCAAATCCTAGTGTCACCAGAAGCGTTGCTCTGCAACTTGGGTTACAGCAACGACAAAGTCCAAGCAATCACCGGTGACAGGACTTGCAAGG
GTAAATTCCATCCGGCAGCAATAAACGACTTCAATTACCCGTCAATTACCGCTGCCATCCAGCCCAAGAGTGTTGCGTCCTTCTCTGTTCAATTTACGAG
AACGGTAACGAATGTCGGATCTGCGAAGTCGACGTACAAAGCACAAATTGTCGGCGGGAAAGGGCTGAAGATTGAAGTGACGCCGCCAATTCTGACATTT
GCGTCTTTAAATGAGAAGATGACTTTCAATGTGACTGTTTCTGGTGGTAAGGTTCCATCCAAGGAATATTTTGCATCCGCTTCGTTGATTTGGAGTGACG
GGACTCGTACCGTTACGAGTCCGATTGTCGTCTACACATAG
AA sequence
>Lus10016483 pacid=23144813 polypeptide=Lus10016483 locus=Lus10016483.g ID=Lus10016483.BGIv1.0 annot-version=v1.0
MTGQILVSPEALLCNLGYSNDKVQAITGDRTCKGKFHPAAINDFNYPSITAAIQPKSVASFSVQFTRTVTNVGSAKSTYKAQIVGGKGLKIEVTPPILTF
ASLNEKMTFNVTVSGGKVPSKEYFASASLIWSDGTRTVTSPIVVYT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G58840 Subtilase family protein (.1) Lus10016483 0 1
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10010699 3.5 0.7563
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10002613 8.0 0.7366
Lus10000400 13.3 0.7295
AT2G29110 ATGLR2.8 glutamate receptor 2.8 (.1) Lus10026877 15.4 0.7295
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10029390 17.2 0.7295
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10029913 18.8 0.7295
AT2G29260 NAD(P)-binding Rossmann-fold s... Lus10016500 19.3 0.5764
AT4G36040 J11 DnaJ11, Chaperone DnaJ-domain ... Lus10017263 20.2 0.6781
AT5G18460 Protein of Unknown Function (D... Lus10006860 20.3 0.7295
Lus10009372 21.7 0.7295

Lus10016483 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.