Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06060 128 / 7e-38 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G29360 125 / 7e-37 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G29260 124 / 5e-36 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT1G07440 122 / 1e-35 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT2G29350 121 / 2e-35 SAG13 senescence-associated gene 13 (.1.2.3) AT1G07450 119 / 3e-34 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G30670 118 / 4e-34 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G29290 116 / 2e-33 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT2G29150 115 / 4e-33 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT2G29340 115 / 4e-33 NAD-dependent epimerase/dehydratase family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040737 [exp] 185 / 3e-60 AT2G29350 332 / 3e-115 senescence-associated gene 13 (.1.2.3) Lus10016494 [exp] 162 / 5e-51 AT5G06060 333 / 7e-116 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10001560 [exp] 147 / 5e-44 AT5G06060 350 / 1e-120 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10040736 [exp] 135 / 1e-40 AT5G06060 382 / 3e-135 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10004985 [exp] 136 / 6e-40 AT2G29340 322 / 5e-110 NAD-dependent epimerase/dehydratase family protein (.1.2.3) Lus10040271 [exp] 126 / 4e-37 AT5G06060 388 / 2e-137 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10010873 [exp] 125 / 6e-37 AT5G06060 308 / 2e-106 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10004704 [exp] 124 / 5e-36 AT5G06060 387 / 3e-137 NAD(P)-binding Rossmann-fold superfamily protein (.1) Lus10040730 [exp] 122 / 5e-35 AT2G29260 405 / 2e-142 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G245000 [exp] 134 / 5e-40 AT2G29150 343 / 9e-120 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.005G039300 [exp] 124 / 2e-36 AT2G29150 356 / 7e-125 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.005G039500 [exp] 124 / 2e-36 AT2G29150 351 / 5e-123 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.010G142600 [exp] 123 / 4e-36 AT2G29290 354 / 3e-124 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.008G059100 [exp] 123 / 8e-36 AT5G06060 416 / 8e-149 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.013G026000 [exp] 120 / 7e-35 AT2G29290 362 / 2e-127 NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.010G199700 [exp] 114 / 2e-34 AT5G06060 145 / 1e-44 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.008G107001 [exp] 114 / 9e-34 AT2G29260 132 / 1e-38 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.001G244900 [exp] 118 / 2e-33 AT2G29260 387 / 4e-135 NAD(P)-binding Rossmann-fold superfamily protein (.1) Potri.006G089700 [exp] 99 / 2e-26 AT5G06060 320 / 6e-111 NAD(P)-binding Rossmann-fold superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016495 pacid=23144789 polypeptide=Lus10016495 locus=Lus10016495.g ID=Lus10016495.BGIv1.0 annot-version=v1.0 ATGAGAAAACATGTATATAACATGTTATACTATGTTGCAGGAGCAATCAATCAACTTGCCAGAAGTCTGGCATGCGAGTGGGCCAAAGACAACATAAGGA CCAACTCCGTTGCGCCTGCTTATACCAGAACTCCGTTTGTCGAGCAGGATCTTAAAAACGAGCAACTTCTGAAGCCTTATGTTAAGCAAGCACCTTTGGG GCGGATAGCTGAGCCAGAGGATGTGTCGGCAGTAGTGGCGTTCCTGTGCATGCCAGCTGCATGTTCTGTTACAGGCCAAACCATCACTGTCGAAGGAGGA GTAACCGTCAATGGTTTCTCGCTGTGA
AA sequence Show only first row Show all	>Lus10016495 pacid=23144789 polypeptide=Lus10016495 locus=Lus10016495.g ID=Lus10016495.BGIv1.0 annot-version=v1.0 MRKHVYNMLYYVAGAINQLARSLACEWAKDNIRTNSVAPAYTRTPFVEQDLKNEQLLKPYVKQAPLGRIAEPEDVSAVVAFLCMPAACSVTGQTITVEGG VTVNGFSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10016495 [exp]	0	1
					Lus10029087 [exp]	1.0	0.9613
					Lus10024490 [exp]	2.8	0.9157
AT4G32900			Peptidyl-tRNA hydrolase II (PT...		Lus10011608 [exp]	4.9	0.9066
AT3G47600	MYB	ATMYB94, AtMYBC...	myb domain protein 94 (.1)		Lus10024218 [exp]	5.2	0.8474
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Lus10022760 [exp]	5.7	0.9007
					Lus10014008 [exp]	5.9	0.8778
AT4G15550		IAGLU	indole-3-acetate beta-D-glucos...		Lus10027584 [exp]	6.9	0.8569
					Lus10007244 [exp]	7.5	0.8394
AT5G40960			Protein of unknown function (D...		Lus10032031 [exp]	8.0	0.8330
					Lus10024103 [exp]	11.6	0.8347

Compare expression of checked genes

Lus10016495 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.