Lus10016514 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10016514 pacid=23144798 polypeptide=Lus10016514 locus=Lus10016514.g ID=Lus10016514.BGIv1.0 annot-version=v1.0
ATGAGAATCAGTGAGAGTCAATATCGGCAGATGCGGCATCTTCAAGATTCACAAACTTATCCAAGCCCTCCCATGACCGAACCGAATCGGTCGTCGGTTG
GGTTAGGTTTTATTGAGAATCTTGATGATGCTGCATCGGCAGATATATTGGCTATAAGTAAAATTAATTCTGTTGAACACCGGCAGTTCCGGGAGTTGTT
GAAAAGGGCGCGAGGGATCAAGATTATAGCATCTAAGAATCCGGTGGAAGTTCATATCGAAGCTTATCTAAGGATATATCACAGAGTGGTTGATGGTGCC
CTAAACAAAGAAGATGAATGCGGGCACTACTAG
AA sequence
>Lus10016514 pacid=23144798 polypeptide=Lus10016514 locus=Lus10016514.g ID=Lus10016514.BGIv1.0 annot-version=v1.0
MRISESQYRQMRHLQDSQTYPSPPMTEPNRSSVGLGFIENLDDAASADILAISKINSVEHRQFRELLKRARGIKIIASKNPVEVHIEAYLRIYHRVVDGA
LNKEDECGHY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10016514 0 1
AT2G45400 BEN1 NAD(P)-binding Rossmann-fold s... Lus10004029 1.7 0.7689
AT4G17905 ATL4H RING/U-box superfamily protein... Lus10024405 2.0 0.7766
AT4G13230 Late embryogenesis abundant pr... Lus10038156 2.4 0.7879
AT4G31050 Biotin/lipoate A/B protein lig... Lus10008181 7.9 0.7305
AT4G25400 bHLH bHLH118 basic helix-loop-helix (bHLH) ... Lus10027396 13.5 0.7375
AT4G27300 S-locus lectin protein kinase ... Lus10037865 14.0 0.6817
Lus10026869 22.0 0.6729
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10016211 22.4 0.7650
Lus10031737 28.6 0.6656
AT5G66430 S-adenosyl-L-methionine-depend... Lus10024671 40.3 0.6830

Lus10016514 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.