Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03820 126 / 5e-36 GDSL-like Lipase/Acylhydrolase family protein (.1) AT5G03810 123 / 7e-35 GDSL-like Lipase/Acylhydrolase family protein (.1) AT3G53100 122 / 1e-34 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT5G22810 118 / 3e-33 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G16370 118 / 4e-33 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G14820 88 / 1e-21 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT4G18970 88 / 1e-21 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) AT5G45670 87 / 4e-21 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G33811 87 / 5e-21 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G29670 86 / 9e-21 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040791 [exp] 190 / 8e-61 AT5G03810 465 / 2e-165 GDSL-like Lipase/Acylhydrolase family protein (.1) Lus10008639 [exp] 166 / 2e-51 AT5G03810 463 / 2e-164 GDSL-like Lipase/Acylhydrolase family protein (.1) Lus10008635 [exp] 142 / 4e-42 AT5G03810 460 / 3e-163 GDSL-like Lipase/Acylhydrolase family protein (.1) Lus10035590 [exp] 121 / 2e-34 AT5G03810 427 / 1e-150 GDSL-like Lipase/Acylhydrolase family protein (.1) Lus10006856 [exp] 114 / 3e-31 AT3G16370 507 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10037598 [exp] 113 / 6e-31 AT3G16370 502 / 6e-180 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10035585 [exp] 112 / 8e-31 AT5G03810 419 / 1e-147 GDSL-like Lipase/Acylhydrolase family protein (.1) Lus10006855 [exp] 111 / 2e-30 AT3G16370 445 / 4e-157 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10011998 [exp] 92 / 4e-23 AT1G29670 493 / 4e-176 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G118300 [exp] 134 / 3e-39 AT5G03820 478 / 2e-170 GDSL-like Lipase/Acylhydrolase family protein (.1) Potri.009G151000 [exp] 125 / 6e-36 AT5G22810 504 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.001G191600 [exp] 115 / 9e-32 AT3G16370 410 / 1e-142 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.001G191400 [exp] 111 / 2e-30 AT3G16370 508 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.011G061900 [exp] 90 / 2e-22 AT5G45960 405 / 4e-141 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.011G062000 [exp] 90 / 3e-22 AT5G45960 440 / 8e-155 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G008904 [exp] 87 / 8e-22 AT4G18970 246 / 3e-80 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) Potri.004G064500 [exp] 88 / 2e-21 AT1G29670 527 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.002G018800 [exp] 88 / 2e-21 AT1G75900 415 / 2e-144 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.019G005402 [exp] 87 / 2e-21 AT1G29670 341 / 3e-116 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016524 pacid=23144849 polypeptide=Lus10016524 locus=Lus10016524.g ID=Lus10016524.BGIv1.0 annot-version=v1.0 ATGGATGTTATTTGCGGAGCTTCACTTGTGCTTCTCCTTGCTTCACTCTCTTCACTAATGGTGTCCGCTGATCCTCTCGTACCGTCACTCACCATTTTCG GCGACTCAGTCTCCGACATTGGGAAGAACAACAACCTCATCACTCTCATAAGGGCAAACTTCCCCCCTTACGGAAGGGATTTCGCCGATCATAGACCCAC CGGAAGGTTAAGCAATGGGAAACTAGCTATCGACATCACCGCTGACTATCTCGGTTTCACCTCATACCCACCTCCTTACCTAAGCCTAGAAGCTGAACAC ATGGGAAGTGTTCTGACCGGACTTAATTTCGCTTCCGGTGCTTCCGGTCTCACGAAACCGCTCACCTATATGTAA
AA sequence Show only first row Show all	>Lus10016524 pacid=23144849 polypeptide=Lus10016524 locus=Lus10016524.g ID=Lus10016524.BGIv1.0 annot-version=v1.0 MDVICGASLVLLLASLSSLMVSADPLVPSLTIFGDSVSDIGKNNNLITLIRANFPPYGRDFADHRPTGRLSNGKLAIDITADYLGFTSYPPPYLSLEAEH MGSVLTGLNFASGASGLTKPLTYM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G03820			GDSL-like Lipase/Acylhydrolase...		Lus10016524 [exp]	0	1

Compare expression of checked genes

Lus10016524 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.