Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59410 105 / 2e-30 Rab5-interacting family protein (.1) AT2G29020 76 / 9e-19 Rab5-interacting family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040798 [exp] 132 / 6e-41 AT5G59410 202 / 2e-68 Rab5-interacting family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G241500 [exp] 106 / 9e-31 AT5G59410 188 / 6e-63 Rab5-interacting family protein (.1) Potri.009G032100 [exp] 101 / 8e-29 AT5G59410 155 / 7e-50 Rab5-interacting family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07019 [flax] [poplar] Rab5ip Rab5-interacting protein (Rab5ip)
Representative CDS sequence Show only first row Show all	>Lus10016530 pacid=23144811 polypeptide=Lus10016530 locus=Lus10016530.g ID=Lus10016530.BGIv1.0 annot-version=v1.0 ATGAAAGAATCCAAATCCGCGAAATTGAGTAGCCAGCAGCAAGAGCAGCTACAGCAGCCTTTGCAACAGCAGCACCAAAACGGTCATCTGTCTCCTTCCA AACAGGTGGTGGCCTTGTTGTGTGGATTGATATGGGGTGCCATTCCTTTGGTAGGCGGCATATGGATTGGCATATTTCTTTTGATATCCTCCGGAATCAT TTATGGTTACTACGGAATGATCTTACAAGTGGACGAAGAAGATTTTGGTGGTCATGGAGCACTCCTCCAAGAGGGGCTCTTTGCTTCAATCACTGTCTTT CTGCTCTCGTGGACTCTAGTTTACAGCCTGGCTCACTTCTGA
AA sequence Show only first row Show all	>Lus10016530 pacid=23144811 polypeptide=Lus10016530 locus=Lus10016530.g ID=Lus10016530.BGIv1.0 annot-version=v1.0 MKESKSAKLSSQQQEQLQQPLQQQHQNGHLSPSKQVVALLCGLIWGAIPLVGGIWIGIFLLISSGIIYGYYGMILQVDEEDFGGHGALLQEGLFASITVF LLSWTLVYSLAHF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59410			Rab5-interacting family protei...		Lus10016530 [exp]	0	1
AT3G26340			N-terminal nucleophile aminohy...		Lus10011369 [exp]	1.4	0.9554
AT1G42960			unknown protein		Lus10012242 [exp]	2.0	0.9395
					Lus10023559 [exp]	6.0	0.9375
AT3G01280		VDAC1, ATVDAC1	ARABIDOPSIS THALIANA VOLTAGE D...		Lus10013271 [exp]	7.4	0.9361
AT1G64520		RPN12A	regulatory particle non-ATPase...		Lus10032420 [exp]	8.4	0.9285
AT4G39520			GTP-binding protein-related (....		Lus10005800 [exp]	9.8	0.9347
AT5G59410			Rab5-interacting family protei...		Lus10040798 [exp]	9.9	0.9253
AT2G34560			P-loop containing nucleoside t...		Lus10023310 [exp]	10.4	0.9191
AT2G44050		COS1	coronatine insensitive1 suppre...		Lus10028541 [exp]	12.0	0.9071
AT3G25545			unknown protein		Lus10013064 [exp]	13.0	0.9141

Compare expression of checked genes

Lus10016530 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.