Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040802 [exp] 66 / 2e-15 AT4G31380 95 / 2e-25 FPF1-like protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G031600 [exp] 63 / 2e-14 AT5G24860 114 / 6e-34 ARABIDOPSIS FLOWERING PROMOTING FACTOR 1, flowering promoting factor 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016534 pacid=23144871 polypeptide=Lus10016534 locus=Lus10016534.g ID=Lus10016534.BGIv1.0 annot-version=v1.0 ATGTCCGGCGTCTGGATATTCGACCGGCGAGGAGTCGCCCGACTCATATCCCACCCGACCCGCGAGTCCTTCGAGCAGAGAGACCACCCCAACCACAACC ACAAGGGGACCGCCAGTCTACCTTCCGGAAGACCAGGTGATCAAGTCGTACGACCAGCTAGAGCAGCGACTGGGGGAGCTCGGGTGGACCCGGTATCGCG GACCGGACAGGAAGGATAA
AA sequence Show only first row Show all	>Lus10016534 pacid=23144871 polypeptide=Lus10016534 locus=Lus10016534.g ID=Lus10016534.BGIv1.0 annot-version=v1.0 MSGVWIFDRRGVARLISHPTRESFEQRDHPNHNHKGTASLPSGRPGDQVVRPARAATGGARVDPVSRTGQEG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10016534 [exp]	0	1
AT4G01290			unknown protein		Lus10039283 [exp]	2.4	0.9879
AT1G65870			Disease resistance-responsive ...		Lus10016231 [exp]	2.6	0.9918
AT1G44760			Adenine nucleotide alpha hydro...		Lus10042701 [exp]	3.6	0.9801
AT5G53950	NAC	ATCUC2, CUC2, A...	CUP-SHAPED COTYLEDON 2, Arabid...		Lus10005537 [exp]	4.7	0.9902
AT5G14070		ROXY2	Thioredoxin superfamily protei...		Lus10011333 [exp]	8.8	0.9839
AT3G05600			alpha/beta-Hydrolases superfam...		Lus10029878 [exp]	8.9	0.9862
AT3G26120		TEL1	terminal EAR1-like 1 (.1)		Lus10002046 [exp]	9.4	0.9833
					Lus10026293 [exp]	9.7	0.9853
					Lus10041871 [exp]	9.8	0.9841
					Lus10007549 [exp]	10.4	0.9831

Compare expression of checked genes

Lus10016534 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.