Lus10016546 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040811 70 / 2e-17 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G239650 44 / 4e-07 AT3G09390 60 / 1e-13 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1)
Potri.009G030800 41 / 4e-06 AT3G09390 64 / 2e-15 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1)
Potri.019G100001 40 / 4e-06 AT3G09390 64 / 4e-15 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1)
Potri.001G041268 40 / 5e-06 AT3G09390 42 / 1e-06 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1)
Potri.001G040200 40 / 5e-06 AT3G09390 42 / 1e-06 ARABIDOPSIS THALIANA METALLOTHIONEIN-K, ARABIDOPSIS THALIANA METALLOTHIONEIN-1, metallothionein 2A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01439 Metallothio_2 Metallothionein
Representative CDS sequence
>Lus10016546 pacid=23144872 polypeptide=Lus10016546 locus=Lus10016546.g ID=Lus10016546.BGIv1.0 annot-version=v1.0
ATGTCTTGCTGCGGAGGAAAGTGCGGATGCGGCTCAGCCTGCAAGTGCGGCAGTGGCTGTAACGGCTGTGGGATGTACCCAGACCTGGCCGAGGCATCCA
CCGCCTCCACCCAGACCATGATCGTCGGCGTTGCTCCGGCCATGGGGTTCGACATGTCGGAGATGAGCTTCGGCGCCGAGGGCGACTGCAAGTGCGGATC
CAACTGCACCTGCACCAACTGCGGCTGCGGCAAGTGA
AA sequence
>Lus10016546 pacid=23144872 polypeptide=Lus10016546 locus=Lus10016546.g ID=Lus10016546.BGIv1.0 annot-version=v1.0
MSCCGGKCGCGSACKCGSGCNGCGMYPDLAEASTASTQTMIVGVAPAMGFDMSEMSFGAEGDCKCGSNCTCTNCGCGK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G02380 MT2B metallothionein 2B (.1) Lus10016546 0 1
AT1G08315 ARM repeat superfamily protein... Lus10039500 1.0 0.9016
AT2G25625 unknown protein Lus10008096 2.0 0.8770
AT4G16400 unknown protein Lus10016614 2.4 0.8565
AT1G61600 Protein of unknown function (D... Lus10035379 7.3 0.8737
AT1G21680 DPP6 N-terminal domain-like pr... Lus10028545 7.5 0.8507
AT1G68110 ENTH/ANTH/VHS superfamily prot... Lus10034431 8.0 0.8222
AT3G61200 Thioesterase superfamily prote... Lus10000809 8.5 0.8708
AT3G61920 unknown protein Lus10030204 10.2 0.8454
AT1G01500 Erythronate-4-phosphate dehydr... Lus10036394 19.3 0.8016
AT5G53400 BOB1, BOBBER1 BOBBER1, HSP20-like chaperones... Lus10018250 21.5 0.8466

Lus10016546 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.