Lus10016550 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 219 / 6e-68 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 189 / 2e-56 Mitochondrial transcription termination factor family protein (.1)
AT1G61980 124 / 1e-31 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 122 / 3e-31 Mitochondrial transcription termination factor family protein (.1.2)
AT3G46950 115 / 2e-28 Mitochondrial transcription termination factor family protein (.1)
AT5G23930 115 / 2e-28 Mitochondrial transcription termination factor family protein (.1)
AT5G64950 114 / 2e-28 Mitochondrial transcription termination factor family protein (.1)
AT1G61960 114 / 4e-28 Mitochondrial transcription termination factor family protein (.1)
AT1G62110 113 / 1e-27 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 112 / 1e-27 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040817 600 / 0 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 445 / 2e-156 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 387 / 8e-134 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10016551 291 / 2e-97 AT5G07900 144 / 3e-40 Mitochondrial transcription termination factor family protein (.1)
Lus10016553 270 / 2e-89 AT5G07900 171 / 7e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10040818 268 / 2e-88 AT5G07900 129 / 2e-34 Mitochondrial transcription termination factor family protein (.1)
Lus10040819 241 / 6e-78 AT5G07900 130 / 2e-35 Mitochondrial transcription termination factor family protein (.1)
Lus10002883 186 / 3e-55 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10040462 165 / 1e-49 AT5G07900 93 / 1e-22 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G046700 246 / 2e-78 AT5G07900 241 / 5e-76 Mitochondrial transcription termination factor family protein (.1)
Potri.014G133200 238 / 5e-75 AT5G07900 436 / 3e-152 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038500 234 / 9e-74 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.010G022700 224 / 3e-70 AT5G07900 220 / 5e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012900 224 / 1e-69 AT5G07900 220 / 6e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038400 221 / 1e-68 AT5G07900 237 / 1e-74 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012400 221 / 1e-68 AT5G07900 212 / 9e-65 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013100 214 / 6e-66 AT5G07900 198 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.011G005100 212 / 3e-65 AT5G07900 199 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.012G046800 210 / 1e-64 AT5G07900 228 / 4e-71 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10016550 pacid=23144805 polypeptide=Lus10016550 locus=Lus10016550.g ID=Lus10016550.BGIv1.0 annot-version=v1.0
ATGATCCACCGACTGCGGCATTTTCTGAAGAATTGTTACCTTCATAGCGATAGATCATTGCAGTCTCTACGGCAGTTTTCGAGCGAATCCTCGGTCAACT
CTTTTGCTCTGTCTTATCTGATCAACGAATGTAATCTCCGTCCCGAGAAAGCCGCAGATTGTGTTAAGTACGCCCGTTTCAAATCTCCCGATAAACCAAA
TCTAGTCCTGCAGTTCTTGAAAAACCTCGGATTCTCCAGCTCCCAAATCCCTATAATCATCGGTAGATGTCCCAGGCTGCTACATTGCGATCCTCAGAAA
CGTTTCGTGACCAAGATTGATTTACTCGAATCCAACGGGTTCGCCCCCTCCGCCATTGTTCAAGTCCTATTAAGAGCTCCGAGGATTCTCCAGTCCAGCG
TAGAAAAACACCTCCTCCCGAATCTCAACTTCGTTAAGAGCATCCTTCAATCCGATGAGAAGGTGATTCGTGCTGTTAGGCGAAGTCCATTCCTGTTGAC
TTGCAATCTGGAGACGTATTTGATCCCGAGCATCAACATTCTGAGGGAGAACGGTGTTGGCGAATCGAGCATTGTCTGGTTACTCGAGTACAACCTGATG
ATTATGATGATTTCCGAAACTCTGCTCTTTGAGGCTGTTGAGCGTGTGAAGAAGATGGGAATGGATCCAAAGTTGGTGACGTTCGGCCTTGCTGTTCGGA
CGATCAGAGGGCTAACGAAAAAGTCGTGGGAGAGTAAGGTTGATGCTTATAAGAAATGGGGGTGGTCTGAGGAAGTGATTCTGAAAGCGTTTACTAAGTC
TCCTTGGTGTATGGCTTTGTCTGTGAAGAAGATTATGGAGAATATGGATTACTATGTTAATGATATGGGGGTTGATACTTTGTATGTTGCAGACCGGCCT
TTGTTGGTTTCGTTCAGCTTGAAGAAGAGGATTGTGCCCCGGGGTAGTGTCCTACGTGGCTTGGTTTCAAAAGGGTTGATTGAGTCGATAAATTTGCATC
AGTCATTGAAGATTAGTAACGAGTTGTTTGAACAGAGGTTTTTGGTGCCGTACAAGGAGGAGGCTCCTGAACTTTTGGAGCTGTTTCGTGCGAGAATATC
TCAAGAGTGA
AA sequence
>Lus10016550 pacid=23144805 polypeptide=Lus10016550 locus=Lus10016550.g ID=Lus10016550.BGIv1.0 annot-version=v1.0
MIHRLRHFLKNCYLHSDRSLQSLRQFSSESSVNSFALSYLINECNLRPEKAADCVKYARFKSPDKPNLVLQFLKNLGFSSSQIPIIIGRCPRLLHCDPQK
RFVTKIDLLESNGFAPSAIVQVLLRAPRILQSSVEKHLLPNLNFVKSILQSDEKVIRAVRRSPFLLTCNLETYLIPSINILRENGVGESSIVWLLEYNLM
IMMISETLLFEAVERVKKMGMDPKLVTFGLAVRTIRGLTKKSWESKVDAYKKWGWSEEVILKAFTKSPWCMALSVKKIMENMDYYVNDMGVDTLYVADRP
LLVSFSLKKRIVPRGSVLRGLVSKGLIESINLHQSLKISNELFEQRFLVPYKEEAPELLELFRARISQE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G07900 Mitochondrial transcription te... Lus10016550 0 1
AT5G62350 Plant invertase/pectin methyle... Lus10027198 1.0 0.8720
AT1G70350 unknown protein Lus10030618 11.9 0.8661
AT5G46290 KAS1, KAS I, KA... KETOACYL-ACP SYNTHASE 1, 3-ket... Lus10040883 11.9 0.8588
AT1G09130 ATP-dependent caseinolytic (Cl... Lus10020649 14.8 0.8300
AT3G12110 ACT11 actin-11 (.1) Lus10005163 23.3 0.8094
AT2G18410 unknown protein Lus10009164 23.5 0.8072
AT1G54385 ARM repeat superfamily protein... Lus10007428 26.3 0.8166
AT3G46740 MAR1, TOC75-III... MODIFIER OF ARG1 1, translocon... Lus10001566 28.8 0.8194
AT1G67680 SRP72 RNA-binding domain (.1) Lus10037059 31.2 0.8369
AT1G06070 bZIP AtbZIP69 Basic-leucine zipper (bZIP) tr... Lus10008150 37.7 0.8113

Lus10016550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.