Lus10016551 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 144 / 3e-40 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 115 / 1e-29 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 97 / 1e-22 Mitochondrial transcription termination factor family protein (.1.2)
AT1G62110 95 / 6e-22 Mitochondrial transcription termination factor family protein (.1)
AT1G61980 94 / 6e-22 Mitochondrial transcription termination factor family protein (.1)
AT1G61960 92 / 5e-21 Mitochondrial transcription termination factor family protein (.1)
AT3G46950 91 / 1e-20 Mitochondrial transcription termination factor family protein (.1)
AT1G62085 89 / 6e-20 Mitochondrial transcription termination factor family protein (.1)
AT5G23930 87 / 3e-19 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 85 / 1e-18 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040818 485 / 2e-175 AT5G07900 129 / 2e-34 Mitochondrial transcription termination factor family protein (.1)
Lus10040462 334 / 1e-117 AT5G07900 93 / 1e-22 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 303 / 3e-102 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 291 / 8e-98 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 283 / 2e-94 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10040819 250 / 5e-83 AT5G07900 130 / 2e-35 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 241 / 6e-78 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10002883 165 / 2e-48 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10016553 118 / 9e-32 AT5G07900 171 / 7e-51 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G038500 155 / 8e-45 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.012G046700 155 / 1e-44 AT5G07900 241 / 5e-76 Mitochondrial transcription termination factor family protein (.1)
Potri.010G022700 154 / 2e-44 AT5G07900 220 / 5e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012400 149 / 2e-42 AT5G07900 212 / 9e-65 Mitochondrial transcription termination factor family protein (.1)
Potri.014G133200 148 / 5e-42 AT5G07900 436 / 3e-152 Mitochondrial transcription termination factor family protein (.1)
Potri.008G216200 147 / 8e-42 AT5G07900 217 / 8e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038400 142 / 6e-40 AT5G07900 237 / 1e-74 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012900 142 / 1e-39 AT5G07900 220 / 6e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013100 141 / 3e-39 AT5G07900 198 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.012G046800 136 / 1e-37 AT5G07900 228 / 4e-71 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10016551 pacid=23144860 polypeptide=Lus10016551 locus=Lus10016551.g ID=Lus10016551.BGIv1.0 annot-version=v1.0
ATGATTAACCGGATGCAATCTGTTCTAAAGATTCGACACCTCCATAGCGATGGATTACTATGTTTCGCAGTTCGAAACCATCCGCGGCAGTTCTCGAACG
AATCTGCTGGCAATCAAACCACCACCGCCGGCCCTATTGCTTTGTCTTACCTCATCAACGAATGTGGCATCCGTCCCGAAAAGGCCGCATCCGCCGTCAA
ATACGCCCAATTCAAAACCCCAGAAAAGGCCAATTCGGTCTTGCAATTCTTCAGAACCCTCGGCTTCTCCACCGCCGACATCTCCAAAATCATCGGGAGG
CGTCCTCGTCTGCTACTTTCCGATCCGGACAAACAATTCGCTCCCCGGATTAGTTTCCTGGAATCGCAAGGGTTTTCTCCCTCCGACATTGCTCAAGTCT
TACTGAGAGGTCCTGAGATATTCTATTCCAGCGTAGCCAAACAGCTGCTACCCAATTTTGAATTCATCAAGAGCGTCGTCCTTTCCAGTGAGAAGGCTGT
TCAAGCCATTAGGCGAAGTCCTTTGTTGTTGACTTGTAAGCTGGAGACGTATTTGATCCCGAGCATCGAGACTCTGAAGGAAAACGGGATTAGCGACTCG
AATATTGTACGGTTGCTTGTCTCTAGCCCTTTATTAACTATGTTGACACCGCAGGCTAAATTATCCGAGGCTGTTGAGCGTGTGAAGGAAATGGGGATTG
ATCCTAAGTCGACTACGTTTGCTGTTGCTATGGAGACGATCAAAGCGACTAAAGTGACGTGGGATAGTAAGGTTGATGCTTATAAGAAGTGGGGGGGTGG
TCTGATGAAGTGA
AA sequence
>Lus10016551 pacid=23144860 polypeptide=Lus10016551 locus=Lus10016551.g ID=Lus10016551.BGIv1.0 annot-version=v1.0
MINRMQSVLKIRHLHSDGLLCFAVRNHPRQFSNESAGNQTTTAGPIALSYLINECGIRPEKAASAVKYAQFKTPEKANSVLQFFRTLGFSTADISKIIGR
RPRLLLSDPDKQFAPRISFLESQGFSPSDIAQVLLRGPEIFYSSVAKQLLPNFEFIKSVVLSSEKAVQAIRRSPLLLTCKLETYLIPSIETLKENGISDS
NIVRLLVSSPLLTMLTPQAKLSEAVERVKEMGIDPKSTTFAVAMETIKATKVTWDSKVDAYKKWGGGLMK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G07900 Mitochondrial transcription te... Lus10016551 0 1
AT1G21150 Mitochondrial transcription te... Lus10016552 3.5 0.6867
AT5G07900 Mitochondrial transcription te... Lus10040462 3.5 0.7742
AT3G57610 ADSS, ATPURA adenylosuccinate synthase (.1) Lus10042358 6.9 0.7743
AT4G33480 unknown protein Lus10003851 11.7 0.7264
AT3G14750 unknown protein Lus10005563 14.4 0.6198
AT4G00150 GRAS ATHAM3, SCL6, L... LOST MERISTEMS 3, ARABIDOPSIS ... Lus10004353 15.3 0.7324
AT4G10120 ATSPS4F Sucrose-phosphate synthase fam... Lus10041041 19.4 0.6980
AT5G62620 Galactosyltransferase family p... Lus10036686 26.2 0.6850
AT3G56140 Protein of unknown function (D... Lus10040960 37.1 0.6778
AT2G37250 ADK, ATPADK1 adenosine kinase (.1) Lus10040358 40.3 0.6929

Lus10016551 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.