Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G07900 69 / 5e-15 Mitochondrial transcription termination factor family protein (.1) AT1G21150 68 / 9e-15 Mitochondrial transcription termination factor family protein (.1) AT1G62010 53 / 2e-09 Mitochondrial transcription termination factor family protein (.1) AT1G61980 53 / 2e-09 Mitochondrial transcription termination factor family protein (.1) AT1G62150 52 / 4e-09 Mitochondrial transcription termination factor family protein (.1) AT3G46950 52 / 4e-09 Mitochondrial transcription termination factor family protein (.1) AT1G61970 52 / 6e-09 Mitochondrial transcription termination factor family protein (.1.2) AT1G61960 50 / 1e-08 Mitochondrial transcription termination factor family protein (.1) AT1G61990 50 / 3e-08 Mitochondrial transcription termination factor family protein (.1) AT1G62120 50 / 3e-08 Mitochondrial transcription termination factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016550 [exp] 139 / 3e-41 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1) Lus10040817 [exp] 129 / 2e-37 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1) Lus10004957 [exp] 123 / 4e-35 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1) Lus10016553 [exp] 117 / 7e-34 AT5G07900 171 / 7e-51 Mitochondrial transcription termination factor family protein (.1) Lus10040820 [exp] 119 / 1e-33 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1) Lus10010714 [exp] 57 / 8e-11 AT4G38840 117 / 3e-33 SAUR-like auxin-responsive protein family (.1) Lus10028912 [exp] 55 / 6e-10 AT5G64950 249 / 1e-79 Mitochondrial transcription termination factor family protein (.1) Lus10004329 [exp] 54 / 1e-09 AT5G64950 238 / 2e-75 Mitochondrial transcription termination factor family protein (.1) Lus10029199 [exp] 53 / 2e-09 AT5G64950 226 / 1e-70 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G133200 [exp] 66 / 5e-14 AT5G07900 436 / 3e-152 Mitochondrial transcription termination factor family protein (.1) Potri.001G034600 [exp] 64 / 2e-13 AT5G07900 197 / 4e-59 Mitochondrial transcription termination factor family protein (.1) Potri.011G005100 [exp] 61 / 3e-12 AT5G07900 199 / 1e-59 Mitochondrial transcription termination factor family protein (.1) Potri.004G012900 [exp] 60 / 9e-12 AT5G07900 220 / 6e-68 Mitochondrial transcription termination factor family protein (.1) Potri.004G012400 [exp] 57 / 1e-10 AT5G07900 212 / 9e-65 Mitochondrial transcription termination factor family protein (.1) Potri.001G034933 [exp] 56 / 2e-10 AT5G07900 194 / 3e-58 Mitochondrial transcription termination factor family protein (.1) Potri.004G013000 [exp] 56 / 2e-10 AT5G07900 193 / 1e-57 Mitochondrial transcription termination factor family protein (.1) Potri.004G013100 [exp] 55 / 4e-10 AT5G07900 198 / 1e-59 Mitochondrial transcription termination factor family protein (.1) Potri.001G034500 [exp] 54 / 6e-10 AT5G07900 208 / 2e-63 Mitochondrial transcription termination factor family protein (.1) Potri.012G046800 [exp] 54 / 8e-10 AT5G07900 228 / 4e-71 Mitochondrial transcription termination factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02536 [flax] [poplar] mTERF mTERF
Representative CDS sequence Show only first row Show all	>Lus10016552 pacid=23144808 polypeptide=Lus10016552 locus=Lus10016552.g ID=Lus10016552.BGIv1.0 annot-version=v1.0 ATGGCGGTGTCTGTAAAGAAAATTGGGATGAACATGGATTATTATGTTAACGAGATGGGGTTCGATGCTTTGGATATTGCGGACCGGCCTTTGCTATTGG CGTTCAGCTTGAAGAAGAGGATTGTGCCCCGGGATCGTGTTTTACGTGGCTTGCTTTCGAAAGGGTTGATTGATTCGAGAAGTTTGTTTCAGGCCTTGAC TGTTACGGACGAGATGTTTGAGAAGAAGTATTTGGTGCCTTACAAGGAGGAGGCTTCTGAACTGTTGGAGCTGTTTCGGGAAAATATCAGAGCCTAG
AA sequence Show only first row Show all	>Lus10016552 pacid=23144808 polypeptide=Lus10016552 locus=Lus10016552.g ID=Lus10016552.BGIv1.0 annot-version=v1.0 MAVSVKKIGMNMDYYVNEMGFDALDIADRPLLLAFSLKKRIVPRDRVLRGLLSKGLIDSRSLFQALTVTDEMFEKKYLVPYKEEASELLELFRENIRA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G21150			Mitochondrial transcription te...		Lus10016552 [exp]	0	1
AT1G78610		MSL6	mechanosensitive channel of sm...		Lus10023990 [exp]	2.0	0.6535
AT5G07900			Mitochondrial transcription te...		Lus10016551 [exp]	3.5	0.6867
AT1G15780			unknown protein		Lus10025451 [exp]	10.6	0.5962
AT4G10750			Phosphoenolpyruvate carboxylas...		Lus10000223 [exp]	15.3	0.6487
AT1G17120		CAT8	cationic amino acid transporte...		Lus10005574 [exp]	24.1	0.6110
AT2G44060			Late embryogenesis abundant pr...		Lus10019367 [exp]	24.5	0.6025
AT5G64030			S-adenosyl-L-methionine-depend...		Lus10000839 [exp]	26.8	0.6181
AT1G50660			unknown protein		Lus10002072 [exp]	37.5	0.5915
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10031393 [exp]	39.5	0.5330
AT1G80780			Polynucleotidyl transferase, r...		Lus10032797 [exp]	46.0	0.5326

Compare expression of checked genes

Lus10016552 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.