Lus10016553 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 171 / 1e-50 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 117 / 8e-31 Mitochondrial transcription termination factor family protein (.1)
AT1G62010 82 / 1e-17 Mitochondrial transcription termination factor family protein (.1)
AT3G46950 76 / 1e-15 Mitochondrial transcription termination factor family protein (.1)
AT1G61980 76 / 1e-15 Mitochondrial transcription termination factor family protein (.1)
AT5G64950 74 / 4e-15 Mitochondrial transcription termination factor family protein (.1)
AT1G79220 74 / 5e-15 Mitochondrial transcription termination factor family protein (.1)
AT1G61990 73 / 1e-14 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 73 / 1e-14 Mitochondrial transcription termination factor family protein (.1.2)
AT1G61960 71 / 6e-14 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040820 444 / 6e-158 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 280 / 3e-93 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 270 / 9e-90 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 265 / 1e-87 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10040819 233 / 2e-76 AT5G07900 130 / 2e-35 Mitochondrial transcription termination factor family protein (.1)
Lus10002883 127 / 3e-34 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10016552 117 / 2e-33 AT1G21150 69 / 4e-15 Mitochondrial transcription termination factor family protein (.1)
Lus10016551 118 / 7e-32 AT5G07900 144 / 3e-40 Mitochondrial transcription termination factor family protein (.1)
Lus10008688 119 / 3e-31 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G133200 178 / 1e-53 AT5G07900 436 / 3e-152 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013100 169 / 2e-50 AT5G07900 198 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012400 159 / 1e-46 AT5G07900 212 / 9e-65 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012900 158 / 5e-46 AT5G07900 220 / 6e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.012G046700 157 / 7e-46 AT5G07900 241 / 5e-76 Mitochondrial transcription termination factor family protein (.1)
Potri.011G005100 157 / 1e-45 AT5G07900 199 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.010G022700 150 / 3e-43 AT5G07900 220 / 5e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038500 146 / 2e-41 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013000 141 / 2e-39 AT5G07900 193 / 1e-57 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038400 139 / 1e-38 AT5G07900 237 / 1e-74 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10016553 pacid=23144846 polypeptide=Lus10016553 locus=Lus10016553.g ID=Lus10016553.BGIv1.0 annot-version=v1.0
ATGTTGCGCATATGCCCCGAGATTTTCAGCTCCAGCGTAGAGAACAAGCTGCTCTCTAATTTCAACTACGTTAGAGATGTGATTCAGTGCGAGAACAAAG
TCCTTCGTGCCATAACCCGCACCCCGGGTCTGTTAACTTGGAAGCTGGAGTCCCGTTTGGTGCCCAACATCAAGATTCTTCGAGAATCCGGCTCGTCTGA
ATCCAACGTCGTCATGCTGCTTCTGAACAAGTCTATGGTTCTGCTAACTACACAGTACAATTTCTCGCAGGTTGTCGATTGCGTAAAGCGAATGGGGTTT
CCTCCTCAGTCGACGACTTTCGGTGTAGCGATCCAGGCAGTGAGAGGAATGATCGACGAGTTATGGAGAAATAAGGTTGAAGCTTACAAGAAGTGGGGAT
GGTCTGAGGAAGTGACTTTGAAAGCGTTCACAAAGTGTCCATGGTGTATGGTATTGTCCGAGAAGAAGATCATGGAAAACATGGACTATTATGTTAACCA
AATGGGATTCGAGCCTTTAGAGATTGCGCATCGACCTACTGTGCTTTCGTACAGCTTGAAGAAGAGGATCGTGCCGCGGGATTCTGTTCTGCAGGTGTTG
GTATCGAAAGGGCTGGTCGAGTCTCGAACAATGTCGAATGCGCTGATGATAGATGATGAGAAATTCAGAAGCAAGTTTGTCCTTCCTTATGAGGTCGAAG
CTCCTGAGTTTTTCGAGCTTTTCCGCAAAATGCTGGCCCGAGCTGAAGAGAAGGATCCAGAGATGTGA
AA sequence
>Lus10016553 pacid=23144846 polypeptide=Lus10016553 locus=Lus10016553.g ID=Lus10016553.BGIv1.0 annot-version=v1.0
MLRICPEIFSSSVENKLLSNFNYVRDVIQCENKVLRAITRTPGLLTWKLESRLVPNIKILRESGSSESNVVMLLLNKSMVLLTTQYNFSQVVDCVKRMGF
PPQSTTFGVAIQAVRGMIDELWRNKVEAYKKWGWSEEVTLKAFTKCPWCMVLSEKKIMENMDYYVNQMGFEPLEIAHRPTVLSYSLKKRIVPRDSVLQVL
VSKGLVESRTMSNALMIDDEKFRSKFVLPYEVEAPEFFELFRKMLARAEEKDPEM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G07900 Mitochondrial transcription te... Lus10016553 0 1
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10007208 12.9 0.6302
AT1G30670 bHLH bHLH052 basic helix-loop-helix (bHLH) ... Lus10005451 47.9 0.5983
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10041151 58.0 0.5797
AT1G02205 CER1 ECERIFERUM 1, Fatty acid hydro... Lus10011472 58.3 0.5814
Lus10012623 87.4 0.5297
AT5G53210 bHLH SPCH, bHLH098 SPEECHLESS, basic helix-loop-h... Lus10001066 101.4 0.5646
AT1G69350 Tetratricopeptide repeat (TPR)... Lus10026642 113.8 0.5242
AT1G66350 GRAS RGL1 RGA-like 1 (.1) Lus10041540 115.1 0.5284
AT3G16180 Major facilitator superfamily ... Lus10009506 119.7 0.5242
AT1G21880 LYM1 lysm domain GPI-anchored prote... Lus10006200 120.2 0.5242

Lus10016553 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.