Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47278 112 / 3e-34 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040837 [exp] 160 / 1e-53 AT1G47278 110 / 1e-33 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G029400 [exp] 86 / 5e-24 AT1G47278 81 / 1e-21 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016567 pacid=23144893 polypeptide=Lus10016567 locus=Lus10016567.g ID=Lus10016567.BGIv1.0 annot-version=v1.0 ATGGGACGGAAAGCTGGTCAACTATACATAAACCCCAAGAAGTTTGGCGGCATGGCGAAACCATGCATGACCAACATGATATCCCTGCTGAACTGCTTGT CTATGAATCAGATGAAAAGTGAAAACTGTGCCAAGGAAAAGGAGTTGCTCAGTACTTGTTTGGATGCACAGAACAGCAAAAACAACTCATGGGGAAGCAT CAACTACCATTTGCAGAGGCTGAGCAAAGGAAGGAAGTAA
AA sequence Show only first row Show all	>Lus10016567 pacid=23144893 polypeptide=Lus10016567 locus=Lus10016567.g ID=Lus10016567.BGIv1.0 annot-version=v1.0 MGRKAGQLYINPKKFGGMAKPCMTNMISLLNCLSMNQMKSENCAKEKELLSTCLDAQNSKNNSWGSINYHLQRLSKGRK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G47278			unknown protein		Lus10016567 [exp]	0	1
AT1G08580			unknown protein		Lus10040441 [exp]	3.3	0.8277
AT2G21870		MGP1	MALE GAMETOPHYTE DEFECTIVE 1, ...		Lus10012682 [exp]	4.2	0.7652
AT2G18400			ribosomal protein L6 family pr...		Lus10026015 [exp]	7.6	0.8030
AT1G47278			unknown protein		Lus10040837 [exp]	8.0	0.7385
AT1G34030			Ribosomal protein S13/S18 fami...		Lus10043405 [exp]	8.1	0.7969
AT1G74270			Ribosomal protein L35Ae family...		Lus10035539 [exp]	9.8	0.7768
AT5G41685			Mitochondrial outer membrane t...		Lus10016473 [exp]	9.9	0.7535
AT1G76065			LYR family of Fe/S cluster bio...		Lus10005622 [exp]	11.2	0.7312
AT4G30220		RUXF	small nuclear ribonucleoprotei...		Lus10006867 [exp]	13.6	0.7881
AT3G22660			rRNA processing protein-relate...		Lus10031120 [exp]	15.0	0.7801

Compare expression of checked genes

Lus10016567 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.