Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59305 35 / 0.0005 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040842 [exp] 111 / 6e-34 ND 37 / 8e-05 Lus10005454 [exp] 50 / 1e-09 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G237700 [exp] 52 / 2e-10 AT5G59305 56 / 5e-12 unknown protein Potri.009G029000 [exp] 52 / 3e-10 AT5G59305 51 / 2e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016571 pacid=23144868 polypeptide=Lus10016571 locus=Lus10016571.g ID=Lus10016571.BGIv1.0 annot-version=v1.0 ATGAGTAGCAAGCTTCTCAGATTCCTGCTCTTAGGATGCCTCCTCATCGTTGCTTCGCAACCCGGTTTCTCCGTTGGTGCAGAGTTTCAAGCTATTGGTT CATACGGTTTCAGAGTCAAGCATGTACACTCAAGGTTACGCAAGGAAGGCTCCCCACATTGGGTTGGAGAAGAGAAGGTTTGGAAAACTCCGTCAGGACC CAATCCAGTGGGAAATCACAATCCACCGATCAAGCAATAG
AA sequence Show only first row Show all	>Lus10016571 pacid=23144868 polypeptide=Lus10016571 locus=Lus10016571.g ID=Lus10016571.BGIv1.0 annot-version=v1.0 MSSKLLRFLLLGCLLIVASQPGFSVGAEFQAIGSYGFRVKHVHSRLRKEGSPHWVGEEKVWKTPSGPNPVGNHNPPIKQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10016571 [exp]	0	1
AT2G28315			Nucleotide/sugar transporter f...		Lus10021464 [exp]	2.2	0.9687
AT1G76250			unknown protein		Lus10012274 [exp]	4.5	0.9681
AT1G72620			alpha/beta-Hydrolases superfam...		Lus10019631 [exp]	5.2	0.9656
AT3G59530		LAP3	LESS ADHERENT POLLEN 3, Calciu...		Lus10008151 [exp]	5.5	0.9589
AT5G21482		ATCKX5, CKX7	ARABIDOPSIS THALIANA CYTOKININ...		Lus10038065 [exp]	7.3	0.9445
AT5G46220			Protein of unknown function (D...		Lus10038497 [exp]	8.3	0.9426
AT5G34850		ATPAP26, PAP26	purple acid phosphatase 26 (.1...		Lus10039978 [exp]	8.8	0.9362
AT3G59310			Eukaryotic protein of unknown ...		Lus10025530 [exp]	10.2	0.9498
AT5G60020		LAC17, ATLAC17	laccase 17 (.1)		Lus10019122 [exp]	11.5	0.9568
AT3G50760		GATL2	galacturonosyltransferase-like...		Lus10016302 [exp]	11.5	0.9499

Compare expression of checked genes

Lus10016571 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.