Lus10016573 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G46460 256 / 8e-89 UBC13 ubiquitin-conjugating enzyme 13 (.1)
AT5G59300 258 / 9e-89 ATUBC7, UBC7 ARABIDOPSIS THALIANA UBIQUITIN CARRIER PROTEIN 7, ubiquitin carrier protein 7 (.1)
AT3G55380 246 / 1e-84 UBC14 ubiquitin-conjugating enzyme 14 (.1.2)
AT1G14400 103 / 1e-28 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2)
AT2G02760 103 / 1e-28 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
AT5G62540 102 / 2e-28 UBC3 ubiquitin-conjugating enzyme 3 (.1)
AT1G36340 78 / 9e-19 UBC31 ubiquitin-conjugating enzyme 31 (.1)
AT3G08690 77 / 3e-18 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT1G50490 77 / 4e-18 UBC20 ubiquitin-conjugating enzyme 20 (.1)
AT3G08700 76 / 4e-18 UBC12 ubiquitin-conjugating enzyme 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10040844 281 / 1e-98 AT5G59300 290 / 1e-101 ARABIDOPSIS THALIANA UBIQUITIN CARRIER PROTEIN 7, ubiquitin carrier protein 7 (.1)
Lus10036727 103 / 1e-28 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Lus10037203 103 / 1e-28 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Lus10030786 103 / 3e-28 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Lus10013263 102 / 6e-28 AT2G02760 304 / 6e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Lus10039323 79 / 5e-19 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 79 / 5e-19 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10038827 79 / 6e-19 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014942 79 / 6e-19 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G206832 258 / 3e-89 AT3G46460 263 / 3e-91 ubiquitin-conjugating enzyme 13 (.1)
Potri.010G206766 256 / 1e-88 AT3G46460 261 / 2e-90 ubiquitin-conjugating enzyme 13 (.1)
Potri.008G053800 252 / 4e-87 AT5G59300 264 / 4e-91 ARABIDOPSIS THALIANA UBIQUITIN CARRIER PROTEIN 7, ubiquitin carrier protein 7 (.1)
Potri.008G053900 252 / 5e-87 AT3G55380 287 / 7e-101 ubiquitin-conjugating enzyme 14 (.1.2)
Potri.019G039200 104 / 4e-29 AT2G02760 285 / 2e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Potri.015G064000 104 / 6e-29 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Potri.013G064400 103 / 1e-28 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Potri.012G033000 79 / 3e-19 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.015G023300 79 / 3e-19 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.001G094900 79 / 5e-19 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10016573 pacid=23144898 polypeptide=Lus10016573 locus=Lus10016573.g ID=Lus10016573.BGIv1.0 annot-version=v1.0
ATGTCGTCTCAAGGCAGCCTCCTCCTCCAAAAACAGCTTAAAGATCTTTGCAAGAACCCTGTTGATGGGTTCTCGGCGGGGCTTGTCGATGAGAACAACA
TATTTGAATGGAGTGTTACTATTATTGGGCCGCCTGATACGCTTTACGAGGGAGGGTATTTCAATGCCATCATGAGCTTTCCTTCCAATTACCCAAACAG
CCCTCCAACGGTTAAGTTTATTTCAGAGATGTGGCATCCTAATGTTTATCCAGATGGGCGTGTGTGCATATCAATTCTGCATCCACCTGGTGATGATCCG
AATGGCTATGAACTTGCAAGCGAGCGTTGGATGCCTGTCCATACCGTTGAAAGTATTGTGTTGAGCATCATATCAATGCTCTCAAGCCCTAATGATGAGT
CTCCTGCCAATGTCGAAGCAGCGAAGGAATGGAGAGAGGTGAGGGACGAATTCAAGAAGAAAGTGAGCCGCTGCGTTAGAAGATCACAAGAAATGTCATG
A
AA sequence
>Lus10016573 pacid=23144898 polypeptide=Lus10016573 locus=Lus10016573.g ID=Lus10016573.BGIv1.0 annot-version=v1.0
MSSQGSLLLQKQLKDLCKNPVDGFSAGLVDENNIFEWSVTIIGPPDTLYEGGYFNAIMSFPSNYPNSPPTVKFISEMWHPNVYPDGRVCISILHPPGDDP
NGYELASERWMPVHTVESIVLSIISMLSSPNDESPANVEAAKEWREVRDEFKKKVSRCVRRSQEMS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G59300 ATUBC7, UBC7 ARABIDOPSIS THALIANA UBIQUITIN... Lus10016573 0 1
AT5G59300 ATUBC7, UBC7 ARABIDOPSIS THALIANA UBIQUITIN... Lus10040844 1.0 0.8890
AT2G02760 ATUBC2 ubiquitin-conjugating enzyme 2... Lus10036727 3.0 0.8518
AT5G01970 unknown protein Lus10031947 3.2 0.8685
AT3G54300 ATVAMP727 vesicle-associated membrane pr... Lus10043431 6.5 0.8242
AT5G21090 Leucine-rich repeat (LRR) fami... Lus10026751 10.2 0.8370
AT2G36060 MMZ3 ,UEV1C UBIQUITIN E2 VARIANT 1C, MMS Z... Lus10004211 16.9 0.7783
AT2G02970 GDA1/CD39 nucleoside phosphata... Lus10012825 17.5 0.8440
AT1G11910 ATAPA1, APA1 aspartic proteinase A1 (.1) Lus10043112 17.8 0.8473
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10027570 17.9 0.8398
AT5G25265 unknown protein Lus10041028 18.3 0.8295

Lus10016573 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.