Lus10016574 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07645 222 / 4e-76 ATDSI-1VOC dessication-induced 1VOC superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G237500 223 / 3e-76 AT1G07645 215 / 3e-73 dessication-induced 1VOC superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0104 Glyoxalase PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
Representative CDS sequence
>Lus10016574 pacid=23144841 polypeptide=Lus10016574 locus=Lus10016574.g ID=Lus10016574.BGIv1.0 annot-version=v1.0
ATGGCGTCATCTGCTCTGAAACCAGCGTTTGCATACACAGTGGTGTACGTCAAGGACGTAGCCAAATCAGTAGACTTCTACGCCAAAGCCTTCGGTTACC
ACGTTCGCCGCCTCGACGACTCTTACCGATGGGGAGAGCTGGAGAGCGGGCAGACAACGATAGCGTTCACTCCGATCCACCAGCACGAGACCGATGATAG
GACCGGGGAGGTCCATACTCCTAAATCCGGCAGCGAGCGGCCTCCGATGGAGGTTTGCTTCGCCTATGCGGATGTTGATGCTGGATATAAGAGGGCCGTG
GAGAACGGGGCGACGCCGGTGAGCCCGCCGGAGGACAAGGAATGGGCTCAGAAAGTCGGATACGTTCGTGACCTCGACGGAAATGTGATCAGACTGGGCA
GCCACGTGTCCAGCAAATGA
AA sequence
>Lus10016574 pacid=23144841 polypeptide=Lus10016574 locus=Lus10016574.g ID=Lus10016574.BGIv1.0 annot-version=v1.0
MASSALKPAFAYTVVYVKDVAKSVDFYAKAFGYHVRRLDDSYRWGELESGQTTIAFTPIHQHETDDRTGEVHTPKSGSERPPMEVCFAYADVDAGYKRAV
ENGATPVSPPEDKEWAQKVGYVRDLDGNVIRLGSHVSSK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G07645 ATDSI-1VOC dessication-induced 1VOC super... Lus10016574 0 1
Lus10027052 3.5 0.7192
AT5G45550 MOB1-like MOB1-like, Mob1/phocein family... Lus10007595 9.0 0.7172
AT3G61230 LIM PLIM2c PLIM2c, GATA type zinc finger ... Lus10020687 13.2 0.7572
Lus10023136 31.0 0.6890
AT4G12320 CYP706A6 "cytochrome P450, family 706, ... Lus10024572 33.1 0.6577
AT5G16100 unknown protein Lus10004035 34.3 0.6046
AT3G49680 ATBCAT-3 ,BCAT3 branched-chain aminotransferas... Lus10007246 36.7 0.6685
AT5G16600 MYB ATMYB43 myb domain protein 43 (.1) Lus10010974 39.0 0.6678
AT4G23160 CRK8 cysteine-rich RLK (RECEPTOR-li... Lus10015094 40.4 0.6424
AT4G30880 Bifunctional inhibitor/lipid-t... Lus10016357 41.7 0.6666

Lus10016574 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.