Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G55410 78 / 5e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G55460 74 / 2e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48485 62 / 1e-13 DIR1 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G55450 59 / 2e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48490 58 / 3e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G52130 46 / 2e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G07450 40 / 4e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032575 [exp] 103 / 5e-30 AT5G55410 73 / 2e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10025866 [exp] 62 / 8e-14 AT5G48490 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10038233 [exp] 62 / 1e-13 AT5G48490 78 / 5e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10002741 [exp] 59 / 3e-12 AT5G48490 74 / 3e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039511 [exp] 52 / 5e-10 AT5G48485 80 / 4e-21 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10016323 [exp] 49 / 9e-09 AT5G48490 74 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10030541 [exp] 41 / 2e-05 AT3G07450 116 / 3e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10019030 [exp] 39 / 7e-05 AT4G33550 79 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10005011 [exp] 38 / 0.0002 AT4G33550 78 / 1e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G251000 [exp] 62 / 8e-14 AT5G48485 76 / 2e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G149900 [exp] 57 / 5e-12 AT5G48485 77 / 1e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G112553 [exp] 45 / 3e-07 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.T125404 [exp] 45 / 3e-07 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G271000 [exp] 42 / 5e-06 AT3G52130 127 / 4e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016582 pacid=23143949 polypeptide=Lus10016582 locus=Lus10016582.g ID=Lus10016582.BGIv1.0 annot-version=v1.0 ATGGCCAACCCCAAACAGTGTCTCCCATTCTTGTGCTTGGTGCTGATGATGGCACTCCTTCTCCCTGTGGCAATGGGTGCAGACGGCTCTTCGGATTGTC TCATTGACCCATCCCAGCTGACTATCTGCCGGCCAGCTGTGACCGGTGGAGATCCCCCAGCTCCCACCACTGAATGCTGCAAGGTGGTCAAAACTTCCAA CCTGCCATGTCTCTGCAGGTTTAAGGATTTCCTCCCTGCCTTTGGAATCGACCCACCTCATGCCTTGGCATTGCCTAAGAAATGTGGTCTCAAGACCCCT CCCGAATGCAAATGTGAGTAA
AA sequence Show only first row Show all	>Lus10016582 pacid=23143949 polypeptide=Lus10016582 locus=Lus10016582.g ID=Lus10016582.BGIv1.0 annot-version=v1.0 MANPKQCLPFLCLVLMMALLLPVAMGADGSSDCLIDPSQLTICRPAVTGGDPPAPTTECCKVVKTSNLPCLCRFKDFLPAFGIDPPHALALPKKCGLKTP PECKCE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G55410			Bifunctional inhibitor/lipid-t...		Lus10016582 [exp]	0	1
AT1G76510	ARID		ARID/BRIGHT DNA-binding domain...		Lus10026569 [exp]	1.0	0.9047
					Lus10041974 [exp]	4.0	0.8375
AT1G62975	bHLH	bHLH125	basic helix-loop-helix (bHLH) ...		Lus10006707 [exp]	7.3	0.7858
AT3G59650			mitochondrial ribosomal protei...		Lus10022178 [exp]	7.4	0.7945
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10036719 [exp]	9.9	0.8592
AT2G02850		ARPN	plantacyanin (.1)		Lus10041850 [exp]	9.9	0.8779
AT3G24495		ATMSH7, MSH7, M...	MUTS HOMOLOG 6-2, ARABIDOPSIS ...		Lus10000017 [exp]	14.1	0.7391
AT4G12080	AT-hook	ATAHL1, AHL1	AT-hook motif nuclear-localize...		Lus10000381 [exp]	17.0	0.7622
AT2G32235			unknown protein		Lus10008093 [exp]	17.7	0.7800
AT1G07590			Tetratricopeptide repeat (TPR)...		Lus10029724 [exp]	20.0	0.8103

Compare expression of checked genes

Lus10016582 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.