Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16400 65 / 6e-14 unknown protein AT3G13175 63 / 6e-14 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004418 [exp] 155 / 2e-50 AT4G16400 79 / 3e-20 unknown protein Lus10039068 [exp] 53 / 5e-10 AT4G16400 81 / 7e-20 unknown protein Lus10038791 [exp] 52 / 1e-09 AT4G16400 78 / 1e-18 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G366900 [exp] 84 / 2e-22 AT3G13175 75 / 4e-19 unknown protein Potri.006G017900 [exp] 63 / 3e-14 AT4G16400 85 / 1e-21 unknown protein Potri.016G007101 [exp] 62 / 1e-13 AT4G16400 96 / 3e-26 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10016614 pacid=23143947 polypeptide=Lus10016614 locus=Lus10016614.g ID=Lus10016614.BGIv1.0 annot-version=v1.0 ATGGAGATCCAGCAAAATCTACTCAAATACAAGCTCCACATCATCTCCGCCTTGATCCTATCCCTCCTAATCGCCTCTATAGTCTACCTAGCTCCAAGAT TGCTCAGCATCTTGGCCTATTTCTGGCCCCTCTTCATCTCCACAGGCCTCTTCCTAGGCGCCAGCATCTTCATAGGAAAGACCTCCCTTCTCGCTACCGA TCCAGAATCAGATCCTTCCGCTGAGGACAAGGCTTCTGAGGTTTTGCTGGATTACGTCGTCGGACAACCTCCGTCGTCCGCACACGCCGCGGAGGTGGCC CAGCCCAGGGACAGCTTCAAATCTGAACACGATAACCATACCTGA
AA sequence Show only first row Show all	>Lus10016614 pacid=23143947 polypeptide=Lus10016614 locus=Lus10016614.g ID=Lus10016614.BGIv1.0 annot-version=v1.0 MEIQQNLLKYKLHIISALILSLLIASIVYLAPRLLSILAYFWPLFISTGLFLGASIFIGKTSLLATDPESDPSAEDKASEVLLDYVVGQPPSSAHAAEVA QPRDSFKSEHDNHT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16400			unknown protein		Lus10016614 [exp]	0	1
AT5G02380		MT2B	metallothionein 2B (.1)		Lus10016546 [exp]	2.4	0.8565
AT1G16840			unknown protein		Lus10035733 [exp]	5.9	0.8190
AT1G12910		LWD1, ATAN11	LIGHT-REGULATED WD 1, ANTHOCYA...		Lus10041500 [exp]	5.9	0.8115
AT1G08315			ARM repeat superfamily protein...		Lus10039500 [exp]	7.2	0.8445
AT3G09770		LOG2	LOSS OF GDU 2, RING/U-box supe...		Lus10023182 [exp]	9.5	0.8351
AT3G52105			unknown protein		Lus10011321 [exp]	9.8	0.8194
AT2G29700		ATPH1	pleckstrin homologue 1 (.1)		Lus10040681 [exp]	11.8	0.7991
AT3G23400		FIB4	fibrillin 4, Plastid-lipid ass...		Lus10021209 [exp]	12.0	0.8014
AT5G20650		COPT5	copper transporter 5 (.1)		Lus10022671 [exp]	13.2	0.8133
AT1G07250		UGT71C4	UDP-glucosyl transferase 71C4 ...		Lus10039037 [exp]	17.2	0.7974

Compare expression of checked genes

Lus10016614 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.