Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52820 81 / 2e-19 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G03070 71 / 1e-15 AOP1.1, AOP1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G03050 66 / 5e-14 AOP3 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G80320 59 / 2e-11 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52790 59 / 3e-11 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G28030 57 / 9e-11 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G15540 55 / 7e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52800 48 / 1e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G51310 43 / 1e-05 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G02400 43 / 1e-05 ATGA2OX4, ATGA2OX6, DTA1 DOWNSTREAM TARGET OF AGL15 1, ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 6, Arabidopsis thaliana gibberellin 2-oxidase 4, gibberellin 2-oxidase 6 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016659 [exp] 87 / 1e-21 AT1G52820 445 / 1e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10006575 [exp] 77 / 3e-18 AT1G52820 221 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005516 [exp] 76 / 2e-17 AT1G52820 278 / 7e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023024 [exp] 75 / 7e-17 AT1G52820 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10025760 [exp] 58 / 5e-12 AT1G52820 76 / 1e-17 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10041281 [exp] 60 / 7e-12 AT1G52790 298 / 5e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023160 [exp] 59 / 1e-11 AT1G52820 244 / 1e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10008097 [exp] 57 / 1e-10 AT1G52800 221 / 2e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005776 [exp] 55 / 8e-10 AT1G52790 198 / 2e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G176200 [exp] 93 / 6e-24 AT1G52820 496 / 8e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G175800 [exp] 77 / 6e-18 AT1G52820 338 / 2e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G175900 [exp] 77 / 7e-18 AT1G52820 328 / 2e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176500 [exp] 68 / 1e-14 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176000 [exp] 61 / 4e-12 AT1G52790 460 / 2e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.018G033400 [exp] 61 / 5e-12 AT1G52820 269 / 4e-89 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176100 [exp] 60 / 1e-11 AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G248000 [exp] 59 / 2e-11 AT1G52820 280 / 6e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.003G106900 [exp] 44 / 3e-06 AT4G23340 392 / 1e-137 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.003G128100 [exp] 44 / 6e-06 AT4G23340 458 / 2e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10016660 pacid=23143956 polypeptide=Lus10016660 locus=Lus10016660.g ID=Lus10016660.BGIv1.0 annot-version=v1.0 ATGAGGGGTATAAGGTACGAAGCACCATCTCCAGCTGCTGCTGCTGATGATGGAGAGGCAAAAGTGGGACTGGACTCTCACATGGACCAGGGTTTGACTG CTTTACTCTACGGGAATGATGTCCATGGACTAGCCAACTATTCTGAGGATTCCTTCATTGTCATTCTCGGCGAATCCCTTCACGCATGGACAAATGGTAG GGTGTATTCTCCATACCACAGGGTGAGATTGAAAGGAAAGGAAAGAAGAAGAAGATACACATTCGGAATGTTCTCAGGGTTCAAGCAAGGCTACACTGTC AAGGGTCCAGAGGAAATGGTGGATGAACATCGTCCTTTGCTGTAA
AA sequence Show only first row Show all	>Lus10016660 pacid=23143956 polypeptide=Lus10016660 locus=Lus10016660.g ID=Lus10016660.BGIv1.0 annot-version=v1.0 MRGIRYEAPSPAAAADDGEAKVGLDSHMDQGLTALLYGNDVHGLANYSEDSFIVILGESLHAWTNGRVYSPYHRVRLKGKERRRRYTFGMFSGFKQGYTV KGPEEMVDEHRPLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Lus10016660 [exp]	0	1
					Lus10011686 [exp]	5.0	0.9667
					Lus10018225 [exp]	5.4	0.9793
					Lus10005830 [exp]	7.6	0.9790
					Lus10009618 [exp]	9.3	0.9790
AT1G75790		SKS18	SKU5 similar 18 (.1)		Lus10013556 [exp]	10.8	0.9790
AT1G04645			Plant self-incompatibility pro...		Lus10002219 [exp]	12.0	0.9790
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10039085 [exp]	13.2	0.9790
AT1G61560		ATMLO6, MLO6	MILDEW RESISTANCE LOCUS O 6, S...		Lus10036120 [exp]	13.2	0.9172
AT4G03220			Protein with RNI-like/FBD-like...		Lus10023567 [exp]	14.2	0.9790
AT2G03220		ATFUT1, ATFT1, ...	MURUS 2, ARABIDOPSIS THALIANA ...		Lus10024077 [exp]	15.2	0.9790

Compare expression of checked genes

Lus10016660 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.