Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24100 35 / 0.0004 Uncharacterised protein family SERF (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007122 [exp] 44 / 6e-07 AT3G24100 59 / 1e-12 Uncharacterised protein family SERF (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G055501 [exp] 35 / 0.0004 AT3G24100 42 / 8e-07 Uncharacterised protein family SERF (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04419 [flax] [poplar] 4F5 4F5 protein related disordered region
Representative CDS sequence Show only first row Show all	>Lus10016668 pacid=23143985 polypeptide=Lus10016668 locus=Lus10016668.g ID=Lus10016668.BGIv1.0 annot-version=v1.0 ATGACTCATATCCTTTTTCTTACTCAGAGGGAGCGTGATCGCGACAGAGCTAATGCTCGCAACCCTAAGGGCGGCAAGGGCAAGGACGACGGCTTGACCC CTGAACAGCGCCGCGAGAGGGACGCCAAGGCTCTGCAAGAGAAGGCGGCGAAGAAAGCCGCGCAGGGTTCCGGAGGAAATTCTTCCGGAGGTAAAGGAGA CGCCAAGAAATAA
AA sequence Show only first row Show all	>Lus10016668 pacid=23143985 polypeptide=Lus10016668 locus=Lus10016668.g ID=Lus10016668.BGIv1.0 annot-version=v1.0 MTHILFLTQRERDRDRANARNPKGGKGKDDGLTPEQRRERDAKALQEKAAKKAAQGSGGNSSGGKGDAKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G24100			Uncharacterised protein family...		Lus10016668 [exp]	0	1
AT2G35120			Single hybrid motif superfamil...		Lus10018319 [exp]	4.2	0.8561
AT1G08830		CSD1	copper/zinc superoxide dismuta...		Lus10001719 [exp]	5.1	0.8378
AT1G77180		SKIP	chromatin protein family (.1.2...		Lus10027158 [exp]	13.0	0.8256
AT5G53300		UBC10	ubiquitin-conjugating enzyme 1...		Lus10033937 [exp]	13.6	0.8252
AT5G20570		HRT1, ROC1, RBX...	REGULATOR OF CULLINS-1, RING-b...		Lus10013153 [exp]	14.8	0.7850
AT2G20230			Tetraspanin family protein (.1...		Lus10022841 [exp]	16.5	0.8176
AT3G24100			Uncharacterised protein family...		Lus10007122 [exp]	17.3	0.7729
AT3G56190		ASNAP, ALPHA-SN...	alpha-soluble NSF attachment p...		Lus10032835 [exp]	19.3	0.8064
AT4G34700		CIB22, AtCIB22	B22 subunit of eukaryotic mito...		Lus10018052 [exp]	21.0	0.8197
AT2G27510		ATFD3	ferredoxin 3 (.1)		Lus10034144 [exp]	21.2	0.8324

Compare expression of checked genes

Lus10016668 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.