Lus10016670 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G08690 123 / 3e-36 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT5G56150 121 / 2e-35 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT5G41700 119 / 7e-35 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT1G64230 119 / 1e-34 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT5G53300 119 / 1e-34 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT2G16740 118 / 2e-34 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT4G27960 118 / 3e-34 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT3G08700 111 / 1e-31 UBC12 ubiquitin-conjugating enzyme 12 (.1)
AT3G13550 103 / 4e-28 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2)
AT1G78870 94 / 9e-25 UBC35 ,UBC13A UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007126 255 / 6e-88 AT3G08690 148 / 4e-46 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10028700 124 / 1e-36 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10009422 124 / 1e-36 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10014187 119 / 2e-34 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10022726 119 / 2e-34 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10032352 118 / 4e-34 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10039323 117 / 6e-34 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 117 / 6e-34 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10038827 117 / 8e-34 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G055300 132 / 3e-39 AT5G56150 183 / 9e-60 ubiquitin-conjugating enzyme 30 (.1.2)
Potri.011G168200 123 / 2e-36 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.019G083800 123 / 4e-36 AT5G56150 280 / 1e-98 ubiquitin-conjugating enzyme 30 (.1.2)
Potri.001G471200 122 / 8e-36 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.019G131400 120 / 6e-35 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.003G136200 119 / 1e-34 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.006G110200 119 / 1e-34 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.016G138900 119 / 1e-34 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G094900 117 / 7e-34 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.012G033000 117 / 8e-34 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10016670 pacid=23143967 polypeptide=Lus10016670 locus=Lus10016670.g ID=Lus10016670.BGIv1.0 annot-version=v1.0
ATGGCCCTTTTCTCTGGGCTCAAACTTTTCAGTAGCAAATCCTCCATCAGGAAATCAAAAAAGACCACAACAGAGCGCAGACTCAACAAGGAAATAAAGC
GGGCAAGAGATCACAACATTCCATCCCACTGCAGCTTTGGACCTGCTGAAGATGGTGATGACATCTACAAGCTTCAAGGTGCCATATTTGGTCCAGCTCA
AACACCTTATGAAGGTGGTGTCTTCCTCTTGTCCATCCGTATTCCCAAAAGCTACCCTTTCACCCCTCCAAAGATCAACTTCATCACCAAGGTTTATCAC
CCAAACGTCAGACGAGATGGGAGGATTGAAGTGGATATTCTGGGGAATAACTGGACACCTGCCTTGACAATTGAGAAGCTGTTACTGTCAATTTGCTCAC
TGCTTCCAGACCCAGATCCTGATGCTGATTCTCCACTCAATAATCCTGCTGCTGCCCTCTATCTATCTGATCTCAAATCTTTCAACAGGAAAGCCAGGGA
ATGGACTCTCAAATATGCAATTCTCTGA
AA sequence
>Lus10016670 pacid=23143967 polypeptide=Lus10016670 locus=Lus10016670.g ID=Lus10016670.BGIv1.0 annot-version=v1.0
MALFSGLKLFSSKSSIRKSKKTTTERRLNKEIKRARDHNIPSHCSFGPAEDGDDIYKLQGAIFGPAQTPYEGGVFLLSIRIPKSYPFTPPKINFITKVYH
PNVRRDGRIEVDILGNNWTPALTIEKLLLSICSLLPDPDPDADSPLNNPAAALYLSDLKSFNRKAREWTLKYAIL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G56150 UBC30 ubiquitin-conjugating enzyme 3... Lus10016670 0 1
AT3G08690 ATUBC11, UBC11 ubiquitin-conjugating enzyme 1... Lus10007126 1.0 0.9222
AT2G43290 MSS3 multicopy suppressors of snf4 ... Lus10027701 2.8 0.9031
Lus10033310 4.2 0.8955
AT1G14720 ATXTH28, EXGT-A... xyloglucan endotransglycosylas... Lus10029000 4.5 0.8914
AT3G61920 unknown protein Lus10002686 5.8 0.8619
AT4G00880 SAUR-like auxin-responsive pro... Lus10032949 6.3 0.8854
AT3G07490 AtCML3, AGD11 calmodulin-like 3, ARF-GAP dom... Lus10020389 7.1 0.8766
AT2G46550 unknown protein Lus10023163 7.4 0.8744
AT4G15960 alpha/beta-Hydrolases superfam... Lus10038649 7.7 0.8723
AT1G13970 Protein of unknown function (D... Lus10030425 9.5 0.8264

Lus10016670 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.