Lus10016679 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48760 358 / 8e-128 Ribosomal protein L13 family protein (.1.2)
AT4G13170 353 / 7e-126 Ribosomal protein L13 family protein (.1)
AT3G07110 352 / 2e-125 Ribosomal protein L13 family protein (.1.2)
AT3G24830 352 / 3e-125 Ribosomal protein L13 family protein (.1)
AT1G78630 54 / 6e-09 EMB1473 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007137 383 / 1e-137 AT5G48760 384 / 6e-138 Ribosomal protein L13 family protein (.1.2)
Lus10043151 380 / 4e-136 AT5G48760 380 / 2e-136 Ribosomal protein L13 family protein (.1.2)
Lus10032599 380 / 4e-136 AT5G48760 380 / 2e-136 Ribosomal protein L13 family protein (.1.2)
Lus10011857 367 / 5e-131 AT5G48760 394 / 8e-142 Ribosomal protein L13 family protein (.1.2)
Lus10022793 363 / 1e-129 AT5G48760 390 / 2e-140 Ribosomal protein L13 family protein (.1.2)
Lus10005553 47 / 2e-06 AT1G78630 332 / 8e-116 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G314500 360 / 2e-128 AT5G48760 384 / 7e-138 Ribosomal protein L13 family protein (.1.2)
Potri.017G054600 357 / 3e-127 AT5G48760 351 / 5e-125 Ribosomal protein L13 family protein (.1.2)
Potri.002G242600 348 / 1e-123 AT4G13170 357 / 4e-127 Ribosomal protein L13 family protein (.1)
Potri.001G384600 50 / 2e-07 AT1G78630 351 / 1e-123 embryo defective 1473, Ribosomal protein L13 family protein (.1)
Potri.011G106100 50 / 3e-07 AT1G78630 342 / 3e-120 embryo defective 1473, Ribosomal protein L13 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00572 Ribosomal_L13 Ribosomal protein L13
Representative CDS sequence
>Lus10016679 pacid=23143914 polypeptide=Lus10016679 locus=Lus10016679.g ID=Lus10016679.BGIv1.0 annot-version=v1.0
ATGGTGTCCGGATCAGGGATATGCGCCAAGAGGGTGGTCGTCGACGCACGCCACCACATGCTGGGCCGCCTCTCCTCTATCATAGCCAAGGAGCTCTTGA
ACGGCCAGAAGGTTGTTGTCGTCCGATGCGAGGAAATCTGTATGTCCGGCGGACTGGTCCGCCAGAAAATGAAGTACATGAGGTTCCTTAGGAAGCGCAT
GAACACCAAGCCTTCCCATGGGCCCATTCATTTCCGCGCCCCTTCCAAGATCCTGTGGCGCACAATCCGCGGCATGATTCCTCACAAGACCAAGCGTGGC
GAGGCTGCTCTCGCCAGGTTGAAGGTCTATGAGGGAGTCCCCCCGCCCTACGACAAGGTTAAGAGGATGGTTATCCCCGACGCTCTTAAGGTTTTGAGGT
TGCAGAGTGGACACAAGTACTGCTTGTTGGGTAAACTATCATCTGAAGTTGGATGGAACTACTATGATACCATTAAGGAGCTTGAGAGCAGGAGGAAGGA
GAAGGCAGCAGTGGTGTACGAGAGAAAGAAGCAGTTGGCTAAACTTAGAGCTAAGGCTGAGAAGACAGCTGATGAGAAGCTGGGTGCTCAGCTTGATGTC
ATTGCTCCCATCAAATATTGA
AA sequence
>Lus10016679 pacid=23143914 polypeptide=Lus10016679 locus=Lus10016679.g ID=Lus10016679.BGIv1.0 annot-version=v1.0
MVSGSGICAKRVVVDARHHMLGRLSSIIAKELLNGQKVVVVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKILWRTIRGMIPHKTKRG
EAALARLKVYEGVPPPYDKVKRMVIPDALKVLRLQSGHKYCLLGKLSSEVGWNYYDTIKELESRRKEKAAVVYERKKQLAKLRAKAEKTADEKLGAQLDV
IAPIKY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G48760 Ribosomal protein L13 family p... Lus10016679 0 1
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Lus10005586 1.0 0.9703
AT1G74050 Ribosomal protein L6 family pr... Lus10038775 2.0 0.9628
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Lus10013719 3.9 0.9449
AT5G48760 Ribosomal protein L13 family p... Lus10007137 4.6 0.9536
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10032918 5.3 0.9450
AT2G40510 Ribosomal protein S26e family ... Lus10030533 5.9 0.9265
AT3G16080 Zinc-binding ribosomal protein... Lus10035878 6.0 0.9210
AT4G30840 Transducin/WD40 repeat-like su... Lus10007707 6.7 0.9115
AT5G60670 Ribosomal protein L11 family p... Lus10037402 7.9 0.9234
AT3G11250 Ribosomal protein L10 family p... Lus10014841 9.4 0.9259

Lus10016679 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.