Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22990 177 / 6e-58 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 174 / 9e-57 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 167 / 3e-54 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT5G66110 157 / 6e-50 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT4G38580 154 / 1e-48 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT4G39700 147 / 8e-46 Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 134 / 4e-41 Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 133 / 2e-40 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 94 / 5e-25 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 92 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036004 [exp] 278 / 9e-98 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 221 / 4e-75 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10032446 [exp] 212 / 4e-71 AT1G71050 175 / 2e-56 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10028531 [exp] 190 / 6e-63 AT5G17450 207 / 1e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10009115 [exp] 186 / 3e-61 AT5G17450 206 / 5e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10019676 [exp] 176 / 3e-57 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 176 / 3e-57 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 165 / 5e-53 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10028426 [exp] 157 / 1e-49 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G114600 [exp] 216 / 1e-73 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.017G123400 [exp] 189 / 6e-63 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.005G079800 [exp] 172 / 5e-56 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 167 / 4e-54 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 166 / 2e-53 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.004G175400 [exp] 159 / 1e-50 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.002G092200 [exp] 156 / 8e-50 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G110400 [exp] 155 / 4e-49 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) Potri.009G135300 [exp] 154 / 1e-48 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G003700 [exp] 148 / 2e-46 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10016708 pacid=23149095 polypeptide=Lus10016708 locus=Lus10016708.g ID=Lus10016708.BGIv1.0 annot-version=v1.0 ATGGGGTTGCTCGACTCTCTTTCAGATTACTTATCGGAGTTGTTTATCAATGCCAAGCCAGGACGTAAGCGCAGGGCAATGCAGACAGTAGAAATCAAAG TGAAAATGGACTGCGAAGGCTGTGAAAGGAGAGTCCGAAATTCTGTACTGCACATGAGAGGGGCGAAATCAGTGGAAGTAAGCAGAAAACAGAGCAGGGT AACGGTGACGGGTTACGTGGAACCAAGCAGGGTGTTGAGGAAAGTACAGAGTACGGGGAAGAAAGCAGAGTTTTGGCCGTATGTAGAGTACAATTTGGTA GCGTACCCATACGCGGTAGGAGCATACGATAAAAAGGCTCCGTCTGGTTACGTCAGAAACGTAGCGCAAGCTCTACCCAGTCACAACTCCACCACCGAAA GCTATACTTCCATCTTCAGCGACGACAACCCCAATGCTTGCTCTGTTATGTAG
AA sequence Show only first row Show all	>Lus10016708 pacid=23149095 polypeptide=Lus10016708 locus=Lus10016708.g ID=Lus10016708.BGIv1.0 annot-version=v1.0 MGLLDSLSDYLSELFINAKPGRKRRAMQTVEIKVKMDCEGCERRVRNSVLHMRGAKSVEVSRKQSRVTVTGYVEPSRVLRKVQSTGKKAEFWPYVEYNLV AYPYAVGAYDKKAPSGYVRNVAQALPSHNSTTESYTSIFSDDNPNACSVM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G71050		HIPP20	heavy metal associated isopren...		Lus10016708 [exp]	0	1
AT2G43870			Pectin lyase-like superfamily ...		Lus10011419 [exp]	1.4	0.8893
AT1G22990		HIPP22	heavy metal associated isopren...		Lus10036004 [exp]	1.4	0.8601
AT2G43870			Pectin lyase-like superfamily ...		Lus10002123 [exp]	4.0	0.8527
AT1G65680		ATHEXPBETA1.4, ...	expansin B2 (.1)		Lus10038933 [exp]	7.2	0.8063
AT5G05340			Peroxidase superfamily protein...		Lus10006534 [exp]	9.5	0.8208
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10012478 [exp]	9.8	0.8288
AT2G21610		PE11, ATPE11	A. THALIANA PECTINESTERASE 11,...		Lus10023560 [exp]	12.2	0.8570
AT1G09380			nodulin MtN21 /EamA-like trans...		Lus10001523 [exp]	17.0	0.7796
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10019030 [exp]	18.9	0.7988
					Lus10008034 [exp]	19.0	0.7758

Compare expression of checked genes

Lus10016708 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.