Lus10016711 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G69940 385 / 3e-133 ATPPME1 Pectin lyase-like superfamily protein (.1)
AT5G07410 380 / 2e-131 Pectin lyase-like superfamily protein (.1)
AT5G61680 371 / 3e-128 Pectin lyase-like superfamily protein (.1)
AT5G07420 338 / 5e-115 Pectin lyase-like superfamily protein (.1)
AT5G07430 334 / 2e-113 Pectin lyase-like superfamily protein (.1)
AT5G19730 212 / 2e-65 Pectin lyase-like superfamily protein (.1)
AT1G05310 209 / 6e-64 Pectin lyase-like superfamily protein (.1)
AT2G36710 201 / 1e-60 Pectin lyase-like superfamily protein (.1)
AT5G55590 199 / 2e-60 QRT1 QUARTET 1, Pectin lyase-like superfamily protein (.1)
AT5G47500 197 / 7e-60 PME5 pectin methylesterase 5, Pectin lyase-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036007 343 / 2e-119 AT1G69940 196 / 7e-62 Pectin lyase-like superfamily protein (.1)
Lus10034893 298 / 2e-99 AT5G61680 333 / 2e-113 Pectin lyase-like superfamily protein (.1)
Lus10012942 231 / 7e-73 AT5G19730 594 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10009997 228 / 1e-71 AT5G19730 320 / 1e-107 Pectin lyase-like superfamily protein (.1)
Lus10028364 224 / 5e-71 AT5G19730 437 / 4e-154 Pectin lyase-like superfamily protein (.1)
Lus10041815 221 / 9e-69 AT5G19730 446 / 1e-156 Pectin lyase-like superfamily protein (.1)
Lus10010470 217 / 5e-67 AT1G05310 521 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10043035 213 / 3e-66 AT5G19730 555 / 0.0 Pectin lyase-like superfamily protein (.1)
Lus10011132 214 / 6e-66 AT5G19730 575 / 0.0 Pectin lyase-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G114900 414 / 2e-144 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1)
Potri.012G114266 414 / 2e-144 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1)
Potri.012G112800 414 / 2e-144 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1)
Potri.012G113533 414 / 2e-144 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1)
Potri.012G113433 413 / 3e-144 AT1G69940 416 / 1e-145 Pectin lyase-like superfamily protein (.1)
Potri.006G186100 409 / 1e-142 AT1G69940 412 / 4e-144 Pectin lyase-like superfamily protein (.1)
Potri.006G186000 409 / 1e-142 AT1G69940 412 / 4e-144 Pectin lyase-like superfamily protein (.1)
Potri.015G110700 398 / 2e-138 AT1G69940 393 / 2e-136 Pectin lyase-like superfamily protein (.1)
Potri.006G137100 325 / 2e-109 AT1G69940 355 / 1e-121 Pectin lyase-like superfamily protein (.1)
Potri.014G117100 237 / 3e-75 AT5G19730 320 / 3e-107 Pectin lyase-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF01095 Pectinesterase Pectinesterase
Representative CDS sequence
>Lus10016711 pacid=23149124 polypeptide=Lus10016711 locus=Lus10016711.g ID=Lus10016711.BGIv1.0 annot-version=v1.0
ATGGTTATTCGAGGAGGAGATCATCTCGTGTTTATAACTGTAGTGTTAACGTTACTAGCAGCTGGGGTAAACAAGATTAGTGCGGACGACTTGACACCGA
TCCCAGCGGACAAAGCCCAAGTAGAAGCCTGGTTCAAGGCAAACGTGAAGCCATTAGCAGAGCGCAAGACGACATTGAACGCCACGCTGCTAGCAGCTGA
GGCCAACGCAACAACCATCAAGGTTAGACCGGACGGGAGCGGACAATTCACCACCCTAACCGATGCCATCAACAGCATCCCCAGCGGGAACACCCGACGT
GTCATCATAGACTTGGGTTCGGGCCTCTACACGGAGAAAGTCATGATCGAGAGATCCAGACCGTTCATTACCCTGATTGGCGATCCAAAGGCCATGCCCA
TCTTGCAGTTTGGCGGCACGGCTAGAGAATTCGGAACCGTGTACAGCGCTACTTTACAGATCGAAGCTGATTACTTCGTGGCCACCAACATTATTTTCAA
GAACACGGCGCCTAAGCCCGACGGTACGAAGAAGGGAGAACAAGCGCTGGCACTGAGGATCGGAGGACACATGGCGACATTCTACAACTGCAAGTTCCAC
GGTTTCCAAGACACTCTTTGTGACGACAGAGGGTGGCATTTCTTCAAGGACTGCTACATCGAAGGAACTGTCGATTACATCTTCGGCAGTGGAACGTCGC
TTTACTTGACCACCGAGCTCAAAGTTCTACAAGATGGAAGCTTCGTCACCGCGCAGGCTAGAAACGAACCTGACTCCACGGGCTACTCATTTGTCCACTG
TGACATCACTGGGGCCGTTCAGAAGTCCTTCTTGGGCCGGGCTTGGAGTAAGATGCCCAAGACCGCTTTTCTCTACTGTAACATTGGCTCCGTCATCTGC
CCCTCTGGCTGGTCCGACAATAATAAACCCGAACGTGATGCGACACTGGACTTCCTTGAGTACAAAAACACGGGGCCAGCTGGGATTGCTACAGATCGTG
CTAAATTCAGCAAGCAATTAAGCGACGCTGAAGCGCAACATTACCTTTCTCTAGGCTTTATTCAAGGCTCCTCATGGTTGCTTCCACCTCCAGCATACGT
TTAA
AA sequence
>Lus10016711 pacid=23149124 polypeptide=Lus10016711 locus=Lus10016711.g ID=Lus10016711.BGIv1.0 annot-version=v1.0
MVIRGGDHLVFITVVLTLLAAGVNKISADDLTPIPADKAQVEAWFKANVKPLAERKTTLNATLLAAEANATTIKVRPDGSGQFTTLTDAINSIPSGNTRR
VIIDLGSGLYTEKVMIERSRPFITLIGDPKAMPILQFGGTAREFGTVYSATLQIEADYFVATNIIFKNTAPKPDGTKKGEQALALRIGGHMATFYNCKFH
GFQDTLCDDRGWHFFKDCYIEGTVDYIFGSGTSLYLTTELKVLQDGSFVTAQARNEPDSTGYSFVHCDITGAVQKSFLGRAWSKMPKTAFLYCNIGSVIC
PSGWSDNNKPERDATLDFLEYKNTGPAGIATDRAKFSKQLSDAEAQHYLSLGFIQGSSWLLPPPAYV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Lus10016711 0 1
AT4G33920 Protein phosphatase 2C family ... Lus10000700 2.2 1.0000
AT5G22460 alpha/beta-Hydrolases superfam... Lus10004882 3.7 1.0000
AT1G66950 ABCG39, PDR11, ... ATP-binding cassette G39, plei... Lus10006277 3.9 1.0000
AT2G29670 Tetratricopeptide repeat (TPR)... Lus10025981 4.5 1.0000
AT3G58170 ATBET11, ATBS14... ARABIDOPSIS THALIANA BET1P/SFT... Lus10009926 4.9 0.9990
AT5G51740 Peptidase family M48 family pr... Lus10032437 5.0 1.0000
AT1G35670 CPK11, ATCDPK2,... calcium-dependent protein kina... Lus10017911 5.5 1.0000
AT4G20060 EMB1895 EMBRYO DEFECTIVE 1895, ARM rep... Lus10038371 6.5 1.0000
AT2G37360 ABCG2 ATP-binding cassette G2, ABC-2... Lus10039859 6.7 1.0000
AT5G59380 MBD6, ATMBD6 methyl-CPG-binding domain 6 (.... Lus10029564 6.9 0.9608

Lus10016711 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.