Lus10016725 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G61990 132 / 3e-35 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G64320 117 / 4e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G22470 116 / 5e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G62680 112 / 2e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G12775 111 / 4e-28 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G19290 109 / 2e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G46100 108 / 3e-27 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G05670 105 / 3e-26 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
AT1G62914 103 / 2e-25 pentatricopeptide (PPR) repeat-containing protein (.1)
AT2G02150 103 / 2e-25 EMB2794 EMBRYO DEFECTIVE 2794, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036019 214 / 4e-71 AT1G53330 64 / 3e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10027916 111 / 5e-28 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10012068 110 / 8e-28 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027914 110 / 1e-27 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10036865 107 / 7e-27 AT1G12700 273 / 1e-83 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10007468 106 / 2e-26 AT5G01110 808 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014244 103 / 2e-25 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10021074 102 / 2e-25 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10028943 99 / 4e-25 AT5G01110 299 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G105400 229 / 2e-69 AT5G61990 773 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G236800 121 / 2e-31 AT5G59900 1071 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G045000 118 / 1e-30 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G271200 115 / 8e-30 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G149800 115 / 1e-29 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G271400 115 / 2e-29 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G034200 114 / 2e-29 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G032600 114 / 4e-29 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G038400 114 / 4e-29 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G150100 112 / 1e-28 AT1G62930 442 / 8e-149 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10016725 pacid=23149090 polypeptide=Lus10016725 locus=Lus10016725.g ID=Lus10016725.BGIv1.0 annot-version=v1.0
ATGGAGAAAGCTCTATCTTTATTCGAAGAAATGGTACACAAGGGCTGTCACTCTACGCATGCTTTGAATGCTTTCGTTGATGGCTTCTGCAAATTGGGGA
AGCTGAACCAAGCCAACCAACTGTTGGCAGATACACAGATCGCTCCAAATGAGGTAACGTATACTATTCTGATTGATTGTCATTGCAAGAGTGGGATGAT
GAATGAGGCAGAACGACTCTTTGTTGAGATGCAAAACAAGAATCTGATGCCAAATGTTTTAACATACACTACACTCTTACATGGTTATGAAAGGATGGGA
AGAAGAAAAGAGATTCTTGGTATCTTTGATGAGATGGTTGCCAAAAATATAGAGCTCGATGAGGTCACGTGGAAGCTGATAATTGATACTTGTTTGAAAG
AAAGTAACTTGTTGAAGGCTTTGAAGTTGGTAGATGACATGGCACTGAGCGGTGCAAAAGTAAGTGAAACCATATATGCATTGCTGGTTAATTCCATGTG
TGAAGCTGAGAGTGTCCTTGAAGACTTCAAATTGCTTGATGAAGCCAATGCACAACCATATAGGCTTAGCATTAGTACCTGCAGGACTCTCATTCATGGT
CTTCACAGAGCAGGAAGGGCAGACAAAGCAAACAGCTTTCAGAGGGCATTAGTAGGTTAA
AA sequence
>Lus10016725 pacid=23149090 polypeptide=Lus10016725 locus=Lus10016725.g ID=Lus10016725.BGIv1.0 annot-version=v1.0
MEKALSLFEEMVHKGCHSTHALNAFVDGFCKLGKLNQANQLLADTQIAPNEVTYTILIDCHCKSGMMNEAERLFVEMQNKNLMPNVLTYTTLLHGYERMG
RRKEILGIFDEMVAKNIELDEVTWKLIIDTCLKESNLLKALKLVDDMALSGAKVSETIYALLVNSMCEAESVLEDFKLLDEANAQPYRLSISTCRTLIHG
LHRAGRADKANSFQRALVG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G61990 Pentatricopeptide repeat (PPR)... Lus10016725 0 1
AT3G23240 AP2_ERF ERF1, ATERF1 ethylene response factor 1 (.1... Lus10014655 2.0 0.7644
AT4G18050 ABCB9, PGP9 ATP-binding cassette B9, P-gly... Lus10004583 3.7 0.7842
AT4G15440 CYP74B2, HPL1 hydroperoxide lyase 1 (.1) Lus10035294 6.5 0.6811
AT1G62300 WRKY ATWRKY6, WRKY6 WRKY family transcription fact... Lus10021554 7.9 0.7644
AT4G04750 Major facilitator superfamily ... Lus10018957 10.5 0.7566
AT5G66660 Protein of unknown function (D... Lus10018880 12.1 0.7307
AT5G42905 Polynucleotidyl transferase, r... Lus10006008 12.2 0.7226
AT1G52780 Protein of unknown function (D... Lus10033064 13.3 0.7217
AT4G02250 Plant invertase/pectin methyle... Lus10001464 13.4 0.7392
AT4G28940 Phosphorylase superfamily prot... Lus10034939 16.7 0.7828

Lus10016725 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.