Lus10016726 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G61990 166 / 2e-47 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G05670 160 / 2e-45 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
AT1G63230 140 / 1e-40 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G39710 142 / 3e-39 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G41170 140 / 4e-39 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT3G53700 140 / 1e-38 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G64583 139 / 1e-38 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G62930 139 / 3e-38 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G07290 139 / 7e-38 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G09820 138 / 8e-38 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036020 380 / 8e-128 AT5G61990 592 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10016729 343 / 2e-118 AT5G39710 243 / 4e-73 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10013283 147 / 6e-41 AT1G05670 785 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Lus10027916 139 / 6e-38 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027914 139 / 9e-38 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10019524 139 / 9e-38 AT3G54980 716 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10012068 138 / 1e-37 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10021074 134 / 2e-37 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10010410 137 / 4e-37 AT5G59900 998 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G105400 251 / 8e-78 AT5G61990 773 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.010G035700 166 / 1e-47 AT1G05670 922 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Potri.005G050180 161 / 2e-46 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050400 155 / 2e-44 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050300 155 / 3e-44 AT1G12700 466 / 5e-156 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050500 155 / 5e-44 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G046100 153 / 4e-43 AT1G12700 512 / 1e-173 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050240 150 / 2e-42 AT1G12700 465 / 1e-155 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G034300 148 / 2e-42 AT1G62930 397 / 4e-133 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G038400 149 / 5e-42 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10016726 pacid=23149122 polypeptide=Lus10016726 locus=Lus10016726.g ID=Lus10016726.BGIv1.0 annot-version=v1.0
ATGATGGACAGGGGAATAAAGCCAAATGTATATACTTATGGAGCGTTTATTCATGCATACTGTAGAGCAGGGCAAATGCATGCTGCACAGAATTGCTTCA
CAGAGATGCTTGGCTATGGTATTGAACCTAATGACGTGGTATATACAGCCCTCGTTAATGGGCATTGCAAGGATGGTGACACGACACAGGCGTTCGCAAC
GTTTAGATCTATGCTAGAAAAAGGCGTGCTACCGGATATTCAAACTTATAGTGCGTTCATCCATGGTCTTTCTATGATTGGAAAGCTTCAGGAATTTATG
TCTGTTTTCTCTCAAATGCTTGAAAGAAATTTGGAACCTGATGTATTTTCTTATAACTCTCTCATTTCCGGCTTCCTTAAGCAAGGTGATATAGACGCGG
CTTTTGAACTCCATGTTGATCTGTGTCAAAAAAATGTTGGTCCAAATATTGTTACTTATAATACACTTGTAAATGGACTTTTGAAGGCTGGCGAACTTGA
TGAAATTCAAGTGAAGGGTTTGACTCGGAACAGTGTTACTTATGCCACAATGATTGATGGATACAGCAAATCTGGCAGTATAAAGCGGAAGCTGTTCCTC
CTGATAGCTATGTATATTGTGCCCTGA
AA sequence
>Lus10016726 pacid=23149122 polypeptide=Lus10016726 locus=Lus10016726.g ID=Lus10016726.BGIv1.0 annot-version=v1.0
MMDRGIKPNVYTYGAFIHAYCRAGQMHAAQNCFTEMLGYGIEPNDVVYTALVNGHCKDGDTTQAFATFRSMLEKGVLPDIQTYSAFIHGLSMIGKLQEFM
SVFSQMLERNLEPDVFSYNSLISGFLKQGDIDAAFELHVDLCQKNVGPNIVTYNTLVNGLLKAGELDEIQVKGLTRNSVTYATMIDGYSKSGSIKRKLFL
LIAMYIVP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G61990 Pentatricopeptide repeat (PPR)... Lus10016726 0 1
AT1G20960 EMB1507 embryo defective 1507, U5 smal... Lus10022082 7.9 0.9184
AT5G61990 Pentatricopeptide repeat (PPR)... Lus10016727 15.7 0.9046
AT1G22060 unknown protein Lus10033461 18.0 0.8869
AT1G05055 ATGTF2H2, GTF2H... general transcription factor I... Lus10029294 19.7 0.8559
AT1G20960 EMB1507 embryo defective 1507, U5 smal... Lus10042628 20.5 0.8956
AT5G61990 Pentatricopeptide repeat (PPR)... Lus10036020 23.7 0.8908
AT1G31430 Pentatricopeptide repeat (PPR-... Lus10004052 26.3 0.8790
AT1G20960 EMB1507 embryo defective 1507, U5 smal... Lus10016048 26.8 0.8880
AT2G22400 S-adenosyl-L-methionine-depend... Lus10020217 30.7 0.8860
AT2G02955 MEE12 maternal effect embryo arrest ... Lus10034720 33.2 0.8598

Lus10016726 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.