Lus10016735 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G51010 161 / 2e-51 Rubredoxin-like superfamily protein (.1)
AT5G17170 52 / 2e-08 ENH1 enhancer of sos3-1, rubredoxin family protein (.1.2)
AT1G54500 40 / 0.0003 Rubredoxin-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022430 244 / 4e-84 AT5G51010 190 / 8e-63 Rubredoxin-like superfamily protein (.1)
Lus10027889 99 / 2e-27 AT5G51010 102 / 2e-29 Rubredoxin-like superfamily protein (.1)
Lus10003157 54 / 4e-09 AT5G17170 377 / 3e-133 enhancer of sos3-1, rubredoxin family protein (.1.2)
Lus10002349 54 / 5e-09 AT5G17170 360 / 5e-126 enhancer of sos3-1, rubredoxin family protein (.1.2)
Lus10015945 45 / 8e-06 AT1G54500 182 / 2e-58 Rubredoxin-like superfamily protein (.1)
Lus10019005 44 / 1e-05 AT1G54500 188 / 1e-60 Rubredoxin-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G108100 153 / 7e-48 AT5G51010 160 / 5e-51 Rubredoxin-like superfamily protein (.1)
Potri.019G042600 51 / 4e-08 AT5G17170 301 / 3e-103 enhancer of sos3-1, rubredoxin family protein (.1.2)
Potri.013G035700 43 / 3e-05 AT1G54500 197 / 2e-64 Rubredoxin-like superfamily protein (.1)
Potri.005G049000 39 / 0.0007 AT1G54500 184 / 3e-59 Rubredoxin-like superfamily protein (.1)
Potri.012G109700 0 / 1 AT5G51010 0 / 1 Rubredoxin-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0045 Rubredoxin PF00301 Rubredoxin Rubredoxin
Representative CDS sequence
>Lus10016735 pacid=23149062 polypeptide=Lus10016735 locus=Lus10016735.g ID=Lus10016735.BGIv1.0 annot-version=v1.0
ATGGCGGTGCATCTACAAGCATCAACGGTAACAAGTAGAAGGCTTAATGGCTCAGAACCCCCTCGGCATCTGTTTGCTGCTCTAAAATCATCCTTCTTCT
CTCCTTCACTCAACTTGTTACCAGCAGTATCCCAACACCCCCGTCGTCCCCTTTCTGCTTCGTCGGCTCCCAAAATCTGCATGCGCCTCGCCTCCAAACA
AGCTTACATTTGCCGGGATTGCGGGTACATTTACAACGACAGAACTCCCTTCGACAAACTCCCTGACACCTACTTCTGCCCTGTTTGCGGTGCATCCAAG
AGAAGATTCAGAGCTTACACTCCATCAGTCACCAAGAATGCAAATGAGAAGGATGTTAGGAAAGCACGCAAAGCTGAACTACAGAGAGACGAAGCTATTG
GGCGAGCTTTGCCAATTGCTCTAGTGGTTGGAATTGCCATTCTCGCTGCAATATACTTCTATCTCAACACTACCTTCCAAAGCTAA
AA sequence
>Lus10016735 pacid=23149062 polypeptide=Lus10016735 locus=Lus10016735.g ID=Lus10016735.BGIv1.0 annot-version=v1.0
MAVHLQASTVTSRRLNGSEPPRHLFAALKSSFFSPSLNLLPAVSQHPRRPLSASSAPKICMRLASKQAYICRDCGYIYNDRTPFDKLPDTYFCPVCGASK
RRFRAYTPSVTKNANEKDVRKARKAELQRDEAIGRALPIALVVGIAILAAIYFYLNTTFQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G51010 Rubredoxin-like superfamily pr... Lus10016735 0 1
AT1G32550 FdC1 ferredoxin C 1, 2Fe-2S ferredo... Lus10004576 6.9 0.8979
AT1G54350 ABCD2 ATP-binding cassette D2, ABC t... Lus10001839 8.1 0.8878
AT1G67440 EMB1688 embryo defective 1688, Minichr... Lus10015794 8.1 0.8402
AT3G17670 tetratricopeptide repeat (TPR)... Lus10007446 14.1 0.8353
AT3G26710 CCB1 cofactor assembly of complex C... Lus10031981 14.3 0.8842
AT2G45630 D-isomer specific 2-hydroxyaci... Lus10041392 15.1 0.8206
AT3G26710 CCB1 cofactor assembly of complex C... Lus10035119 15.7 0.8840
AT1G56180 unknown protein Lus10006532 19.3 0.8703
AT2G26540 ATUROS, ATDUF3,... ARABIDOPSIS THALIANA UROPORPHY... Lus10032769 23.8 0.8252
AT3G53470 unknown protein Lus10019901 26.9 0.8600

Lus10016735 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.