Lus10016743 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G51140 102 / 3e-26 Pseudouridine synthase family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022437 0 / 1 AT5G51140 505 / 1e-177 Pseudouridine synthase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G101300 109 / 5e-29 AT5G51140 512 / 0.0 Pseudouridine synthase family protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10016743 pacid=23149099 polypeptide=Lus10016743 locus=Lus10016743.g ID=Lus10016743.BGIv1.0 annot-version=v1.0
ATGAGGAAGAGGAAGAGGAAGGAAGGAAAAAGACATGGATATTGTCTGGCGAACGCCGGCAAATCCGCCGGAGATGAACGACTACATCATTCGAAACGGT
CAAGAATCGTTGGAACGGGAAGACAATTGTTGATTTGTTCGCGAAATAGTTCAAAGGCAGATGGTACGATTACTACGTATGACAATGTAGATGGTCATTC
ACGAGTTAGTGCTGTGAAGAGTGGACGGATTCAGGTTGATGGAGAGACGATTCCAGTCTCTTATGTGGTCAAAACATCTCAAAAGATAAACCACTTTGTA
CACAGGCATGAACCACCAGTCATGGCCTGCGATATTTCCGTTCTGCAAGAAGATCCTGATGTTGTGACTATTTCAAAGCCAGCAACTGTACCTATTGAAG
CTGGATTAGTGCATAAACAGTATGTAGCGAGGGTTGTTGGTGTATTCCCTGAAGATGAGGTATGA
AA sequence
>Lus10016743 pacid=23149099 polypeptide=Lus10016743 locus=Lus10016743.g ID=Lus10016743.BGIv1.0 annot-version=v1.0
MRKRKRKEGKRHGYCLANAGKSAGDERLHHSKRSRIVGTGRQLLICSRNSSKADGTITTYDNVDGHSRVSAVKSGRIQVDGETIPVSYVVKTSQKINHFV
HRHEPPVMACDISVLQEDPDVVTISKPATVPIEAGLVHKQYVARVVGVFPEDEV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G51140 Pseudouridine synthase family ... Lus10016743 0 1
Lus10017807 4.5 0.7894
Lus10006038 4.7 0.7689
AT3G43610 Spc97 / Spc98 family of spindl... Lus10003353 7.7 0.7805
AT4G01790 Ribosomal protein L7Ae/L30e/S1... Lus10010079 7.9 0.7848
AT1G07745 SSN1, ATRAD51D,... SUPPRESOR OF SNI1, homolog of ... Lus10005437 13.9 0.8151
AT1G60560 SWIM zinc finger family protei... Lus10025765 15.5 0.7839
AT5G45600 TAF14b, GAS41 TBP-ASSOCIATED FACTOR 14B, GLI... Lus10007555 18.9 0.7898
AT1G50910 unknown protein Lus10043058 19.1 0.7864
AT1G63110 GPI transamidase subunit PIG-U... Lus10029590 19.5 0.7707
AT5G37590 Tetratricopeptide repeat (TPR)... Lus10004036 21.9 0.7205

Lus10016743 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.