Plant FIBer expression Database

Lus10016756 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G24500 65 / 3e-15 MBF1C, ATMBF1C multiprotein bridging factor 1C (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021776
[exp]
102 / 2e-29 AT3G24500 202 / 8e-68 multiprotein bridging factor 1C (.1.2)
Lus10034592
[exp]
101 / 7e-29 AT3G24500 201 / 1e-67 multiprotein bridging factor 1C (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G075200
[exp]
82 / 2e-21 AT3G24500 223 / 4e-76 multiprotein bridging factor 1C (.1.2)
Potri.001G390400
[exp]
45 / 3e-07 AT3G58680 242 / 6e-84 multiprotein bridging factor 1B (.1)
Potri.011G109500
[exp]
40 / 3e-05 AT3G58680 240 / 3e-83 multiprotein bridging factor 1B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF08523 MBF1 Multiprotein bridging factor 1
Representative CDS sequence
>Lus10016756 pacid=23149111 polypeptide=Lus10016756 locus=Lus10016756.g ID=Lus10016756.BGIv1.0 annot-version=v1.0
ATGTTGAGCAGATCTACCAGCGTTTCTTCCAAGAACTGGGTTTTCGTGGTGATGTGGAAGGCGAAGCCAACCAAAGCTCAGGAACGCGATCCCAAGGCTG
TGAACCAAACTCTCCGATCAGATGCACCAATTCAAACGATTAAAACATTTGGCGCGAGATCGAACAACAAGCCGACGACGACGGCTCCGGTGTTGAATGC
TCGTAAGCTGGACGAGGGAACCAACCTAGCTCATGTTCTTCTGGTAGAGGACCATACCCGCGCGTGCATCTTGGTGTGA
AA sequence
>Lus10016756 pacid=23149111 polypeptide=Lus10016756 locus=Lus10016756.g ID=Lus10016756.BGIv1.0 annot-version=v1.0
MLSRSTSVSSKNWVFVVMWKAKPTKAQERDPKAVNQTLRSDAPIQTIKTFGARSNNKPTTTAPVLNARKLDEGTNLAHVLLVEDHTRACILV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G24500 MBF1C, ATMBF1C multiprotein bridging factor 1... Lus10016756
[exp]
0 1
AT3G11670 DGD1 DIGALACTOSYL DIACYLGLYCEROL DE... Lus10033686
[exp]
1.0 0.7024
AT2G39730 RCA rubisco activase (.1.2.3) Lus10035616
[exp]
8.5 0.6297
AT2G17030 F-box family protein with a do... Lus10022619
[exp]
10.5 0.6268
Lus10011218
[exp]
12.2 0.6246
AT5G67360 ARA12 Subtilase family protein (.1) Lus10006693
[exp]
15.0 0.6039
AT5G18460 Protein of Unknown Function (D... Lus10006861
[exp]
16.4 0.6039
AT5G12060 Plant self-incompatibility pro... Lus10023085
[exp]
17.7 0.6039
AT5G59550 zinc finger (C3HC4-type RING f... Lus10028009
[exp]
18.4 0.5455
AT5G05320 FAD/NAD(P)-binding oxidoreduct... Lus10034816
[exp]
19.5 0.5666
AT3G46290 HERK1 hercules receptor kinase 1 (.1... Lus10023325
[exp]
21.0 0.5863

Lus10016756 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.