Lus10016762 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G63460 179 / 2e-58 SAP domain-containing protein (.1.2.3.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022457 263 / 2e-90 AT5G63460 169 / 2e-53 SAP domain-containing protein (.1.2.3.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G094600 206 / 1e-68 AT5G63460 201 / 1e-66 SAP domain-containing protein (.1.2.3.4)
Potri.012G096900 189 / 4e-62 AT5G63460 186 / 4e-61 SAP domain-containing protein (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10172 DDA1 Det1 complexing ubiquitin ligase
CL0306 HeH PF02037 SAP SAP domain
Representative CDS sequence
>Lus10016762 pacid=23149079 polypeptide=Lus10016762 locus=Lus10016762.g ID=Lus10016762.BGIv1.0 annot-version=v1.0
ATGGATAAGTCATCTCCTCCTCCTCCAACTCCACATTCCCTTCCGCTTTCCAATTCGAATTCTGGTGCTTCCAAGTTCCTCTCCAACCTCCCCTCTCGCG
GCTTATTGTATTCCACTGTTCTCTCCTCCAACCCGGGTGGAATGCGAGTATATATCTGCGAACATGAAACACTACCTCCAGAGGACCAGCTGATAAAGAC
TAACCAGACAAAAATATTGATTAGATCACTCCAGCTCAAGAAACACAAGGGTGAATCTGGTCCGAAAGATGCAAGTGGATCAAATGCAGCCGAGAGTTCT
AAGAAGAGACCTTCAGAAAGGGCGTTGGAGGGTAGAGGTTCAGCTAAGAGAAACAGTAGCCAGAATGGTCCACAACTTGAAGGGTCTGGAAGCCGCACGG
CTGACAAGGAGTTGTACAGTTTGACTCTGGAGAAACTGCGTGCTCTCCTAAAGGAACGTGGCCTTTCACCAAAGGGGAAGAAGGAGGAACTGGTTGCGAG
GCTAAGAAGTCCAATCGGTTGA
AA sequence
>Lus10016762 pacid=23149079 polypeptide=Lus10016762 locus=Lus10016762.g ID=Lus10016762.BGIv1.0 annot-version=v1.0
MDKSSPPPPTPHSLPLSNSNSGASKFLSNLPSRGLLYSTVLSSNPGGMRVYICEHETLPPEDQLIKTNQTKILIRSLQLKKHKGESGPKDASGSNAAESS
KKRPSERALEGRGSAKRNSSQNGPQLEGSGSRTADKELYSLTLEKLRALLKERGLSPKGKKEELVARLRSPIG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G63460 SAP domain-containing protein ... Lus10016762 0 1
AT5G63460 SAP domain-containing protein ... Lus10022457 1.0 0.9176
AT3G16230 Predicted eukaryotic LigT (.1.... Lus10037578 4.9 0.9083
AT1G77030 hydrolases, acting on acid anh... Lus10000777 7.1 0.8730
AT1G07110 FKFBP, ATF2KP, ... "fructose-2,6-bisphosphatase",... Lus10042278 10.0 0.8966
AT3G63210 MARD1 MEDIATOR OF ABA-REGULATED DORM... Lus10022060 13.5 0.8915
AT3G54440 glycoside hydrolase family 2 p... Lus10024155 13.8 0.9057
AT3G47160 RING/U-box superfamily protein... Lus10001209 13.9 0.9031
AT5G23520 smr (Small MutS Related) domai... Lus10004296 17.8 0.8719
AT5G46410 SSP4 SCP1-like small phosphatase 4 ... Lus10004551 21.7 0.8958
AT3G12300 unknown protein Lus10005383 22.4 0.9017

Lus10016762 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.