Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66590 167 / 6e-53 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G25790 118 / 2e-33 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G57625 116 / 6e-33 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT1G01310 116 / 2e-32 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G33720 107 / 1e-29 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT4G31470 105 / 1e-28 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14610 101 / 1e-27 PR-1, PR1, ATPR1 pathogenesis-related gene 1 (.1) AT3G19690 101 / 1e-27 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT5G26130 97 / 6e-26 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) AT2G14580 97 / 8e-26 ATPRB1 basic pathogenesis-related protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022481 [exp] 277 / 1e-96 AT5G66590 192 / 6e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10020491 [exp] 120 / 6e-35 AT2G14610 207 / 2e-69 pathogenesis-related gene 1 (.1) Lus10020481 [exp] 113 / 7e-32 AT2G14610 176 / 6e-57 pathogenesis-related gene 1 (.1) Lus10020480 [exp] 107 / 1e-29 AT2G14610 182 / 3e-59 pathogenesis-related gene 1 (.1) Lus10012479 [exp] 106 / 2e-29 AT2G14610 208 / 7e-70 pathogenesis-related gene 1 (.1) Lus10020493 [exp] 105 / 4e-29 AT2G14610 206 / 9e-69 pathogenesis-related gene 1 (.1) Lus10005557 [exp] 104 / 2e-28 AT4G31470 199 / 2e-65 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10013693 [exp] 103 / 6e-28 AT4G31470 196 / 1e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Lus10006981 [exp] 102 / 1e-27 AT4G25780 235 / 2e-79 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G130100 [exp] 194 / 1e-63 AT5G66590 196 / 3e-64 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.007G033200 [exp] 187 / 7e-61 AT5G66590 192 / 4e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G083100 [exp] 116 / 2e-33 AT2G14610 201 / 4e-67 pathogenesis-related gene 1 (.1) Potri.009G083300 [exp] 116 / 2e-33 AT2G14610 203 / 9e-68 pathogenesis-related gene 1 (.1) Potri.009G083000 [exp] 113 / 3e-32 AT4G33720 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.009G082900 [exp] 111 / 6e-31 AT2G14610 179 / 5e-58 pathogenesis-related gene 1 (.1) Potri.018G096007 [exp] 109 / 2e-30 AT4G30320 215 / 1e-72 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.006G171300 [exp] 106 / 2e-29 AT4G30320 192 / 2e-63 CAP (Cysteine-rich secretory proteins, Antigen 5, and Pathogenesis-related 1 protein) superfamily protein (.1) Potri.001G288301 [exp] 97 / 1e-25 AT2G14580 202 / 1e-67 basic pathogenesis-related protein 1 (.1) Potri.001G288401 [exp] 94 / 1e-24 AT2G14610 178 / 4e-58 pathogenesis-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0659 [flax] [poplar] CAP PF00188 [flax] [poplar] CAP Cysteine-rich secretory protein family
Representative CDS sequence Show only first row Show all	>Lus10016787 pacid=23149052 polypeptide=Lus10016787 locus=Lus10016787.g ID=Lus10016787.BGIv1.0 annot-version=v1.0 ATGGCTTCTTCCACAATCACAATCCTCCCTCTTCTGATGATTATCCTCGCCTTATCCAACGTCTCTGCTACACCGCCACTGTCGCTGACGACAGATGCTA GAGAGTTTCTGGAAGCACACAATCAAGCGAGAGGTGTTGTAGGAGTAGGTCCTCTGACCTGGAACCGGTCTCTTATGGCCGCCGCCAGTAGGATGGCGAG GATGCAGGGGAATAAACTGAAGTGCGAATTTGCCAACCTGACAAACAACAAATACGGAGGAAATCAGATGTGGGCCAGCGGAAGCGGAGTGACACCGAGG ATGGTGGTGGACAGCTGGGTGGCGGAGAAAAAGTACTACGACCACCGCAGGAACACGTGTGAGGCGGGACATATGTGCGGGGTTTACACGCAGGTGGTGT GGAGAAAGTCCAAGGATCTGGGCTGCGCCTCTGCCACGTGCAGTAAAACCAAATCCGGCGGCGGCACCTTGACAATTTGCTTCTATAACCCTCCTGGAAA TTTCGTCGGCGAGGCCCCTTACTGA
AA sequence Show only first row Show all	>Lus10016787 pacid=23149052 polypeptide=Lus10016787 locus=Lus10016787.g ID=Lus10016787.BGIv1.0 annot-version=v1.0 MASSTITILPLLMIILALSNVSATPPLSLTTDAREFLEAHNQARGVVGVGPLTWNRSLMAAASRMARMQGNKLKCEFANLTNNKYGGNQMWASGSGVTPR MVVDSWVAEKKYYDHRRNTCEAGHMCGVYTQVVWRKSKDLGCASATCSKTKSGGGTLTICFYNPPGNFVGEAPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66590			CAP (Cysteine-rich secretory p...		Lus10016787 [exp]	0	1
AT4G29890			choline monooxygenase, putativ...		Lus10008571 [exp]	7.4	0.9229
AT3G01900		CYP94B2	"cytochrome P450, family 94, s...		Lus10012531 [exp]	9.8	0.9039
AT4G26060			Ribosomal protein L18ae family...		Lus10027625 [exp]	14.6	0.9225
AT4G09460	MYB	ATMYB6, ATMYB8	myb domain protein 6 (.1)		Lus10000411 [exp]	14.7	0.9147
AT5G08300			Succinyl-CoA ligase, alpha sub...		Lus10006405 [exp]	17.2	0.9101
AT2G14095			unknown protein		Lus10012704 [exp]	17.4	0.9151
AT2G36020		HVA22J	HVA22-like protein J (.1)		Lus10016974 [exp]	22.6	0.9160
					Lus10002693 [exp]	24.3	0.9100
AT5G40760		G6PD6	glucose-6-phosphate dehydrogen...		Lus10014615 [exp]	24.4	0.8973
AT3G55520			FKBP-like peptidyl-prolyl cis-...		Lus10040280 [exp]	25.2	0.9136

Compare expression of checked genes

Lus10016787 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.