Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39700 172 / 1e-55 Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 157 / 5e-50 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 147 / 5e-46 Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 145 / 5e-45 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT4G38580 136 / 1e-41 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT5G17450 134 / 7e-41 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT5G66110 124 / 5e-37 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 120 / 2e-35 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 88 / 1e-22 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 83 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022508 [exp] 283 / 1e-99 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 226 / 4e-77 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 225 / 1e-76 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10039419 [exp] 154 / 1e-48 AT4G08570 215 / 5e-73 Heavy metal transport/detoxification superfamily protein (.1) Lus10016708 [exp] 149 / 7e-47 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10036004 [exp] 149 / 2e-46 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 146 / 2e-45 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10009115 [exp] 141 / 2e-43 AT5G17450 206 / 5e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Lus10028531 [exp] 140 / 2e-43 AT5G17450 207 / 1e-69 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G079800 [exp] 207 / 7e-70 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 197 / 7e-66 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 155 / 3e-49 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 155 / 4e-49 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 155 / 5e-49 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.005G003700 [exp] 147 / 7e-46 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1) Potri.017G123400 [exp] 145 / 2e-45 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G175400 [exp] 142 / 9e-44 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.009G135300 [exp] 137 / 5e-42 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G110400 [exp] 124 / 9e-37 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10016812 pacid=23149082 polypeptide=Lus10016812 locus=Lus10016812.g ID=Lus10016812.BGIv1.0 annot-version=v1.0 ATGGGAATTGGAGGAAGTTTGGAGTACTTGTGTGAGTTGATGATGGCAAACTCTGACAAGAAGAAGAAGAAGAGGAAGCAAATGCAGAGTGTGGAGCTGA AGGTGAGGATGGATTGTGATGGATGCGAGCTTAAGGTCAAGAAAGCACTTTCTTCATTAACTGGGGTGAAAAGTGTGGAGATAAACAGGAAGCAGCAGAA GGTGACAGTAACAGGGTATGTTGAACCACACAAGGTACTGAACAAGGCGAAATCAACTGGGAAGAGATGTGAGATTTGGCCATACATTCCATACAACACA GTAGCTCAACCGTATATTGCTGGAACTTACGACAAGAAAGCACCTCCTGGTTATGTAAGAAATGTTGAGCAAAGTAGTGGAACAGCAATCACAAGATATG AAGAAGACCCTTACACCTCCATGTTCAGTGATGCAACCCAAATGGATGTTCCATCATGTAACCACTCTAATTAA
AA sequence Show only first row Show all	>Lus10016812 pacid=23149082 polypeptide=Lus10016812 locus=Lus10016812.g ID=Lus10016812.BGIv1.0 annot-version=v1.0 MGIGGSLEYLCELMMANSDKKKKKRKQMQSVELKVRMDCDGCELKVKKALSSLTGVKSVEINRKQQKVTVTGYVEPHKVLNKAKSTGKRCEIWPYIPYNT VAQPYIAGTYDKKAPPGYVRNVEQSSGTAITRYEEDPYTSMFSDATQMDVPSCNHSN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39700			Heavy metal transport/detoxifi...		Lus10016812 [exp]	0	1
					Lus10021217 [exp]	15.9	0.8820
AT5G45980	HD	WOX9B, STPL, WO...	WUSCHEL related homeobox 9B, S...		Lus10013960 [exp]	22.9	0.8812
AT5G53950	NAC	ATCUC2, CUC2, A...	CUP-SHAPED COTYLEDON 2, Arabid...		Lus10005537 [exp]	29.1	0.8805
AT2G17950	HD	WUS1, PGA6, WUS	WUSCHEL 1, WUSCHEL, Homeodomai...		Lus10041909 [exp]	32.5	0.8803
AT3G27360			Histone superfamily protein (....		Lus10013948 [exp]	36.7	0.8797
					Lus10041871 [exp]	43.9	0.8789
AT5G66580			unknown protein		Lus10000739 [exp]	46.4	0.7832
AT5G45980	HD	WOX9B, STPL, WO...	WUSCHEL related homeobox 9B, S...		Lus10005282 [exp]	46.9	0.8787
AT2G35160		SGD9, SUVH5	SET DOMAIN-CONTAINING PROTEIN ...		Lus10043211 [exp]	50.9	0.8772
AT3G26120		TEL1	terminal EAR1-like 1 (.1)		Lus10002046 [exp]	52.3	0.8767

Compare expression of checked genes

Lus10016812 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.