Lus10016814 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G15120 41 / 0.0002 VQ motif-containing protein (.1)
AT3G22160 40 / 0.0002 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006941 40 / 0.0005 AT1G35830 93 / 3e-21 VQ motif-containing protein (.1)
Lus10024738 40 / 0.0006 AT1G35830 92 / 3e-21 VQ motif-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G075800 63 / 3e-12 AT3G22160 54 / 8e-09 VQ motif-containing protein (.1)
Potri.001G158800 50 / 1e-07 AT4G39720 58 / 6e-10 VQ motif-containing protein (.1)
Potri.005G076600 43 / 6e-05 AT5G65170 70 / 7e-13 VQ motif-containing protein (.1)
Potri.005G166100 39 / 0.0008 AT5G65170 94 / 8e-21 VQ motif-containing protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Lus10016814 pacid=23149146 polypeptide=Lus10016814 locus=Lus10016814.g ID=Lus10016814.BGIv1.0 annot-version=v1.0
ATGAACGATTACAATACTGGTGGTGATGATCAGTACTGGTTTGATAATAATATTACTGTTGGATCCTCCGACAACATGGCGGCGGCTGCTGGGACCAGTA
CTGGTAATCACAGAAGCAGCAGCAGCAGCAGCAGCAAGCCGATTAGGAGGAGGTCGAGGGTGTCAAAGAAGACCCCAATAACACTCCTCAACACAGACGC
CACCAACTTCAGATCCCTCGTCCAGCAGTTCACTGGCTGTCCCCACCCACTGCCGCCCACGTCGACCTCTTTCCAAACGGCGCCGTTGGATACCAATCGC
GGACCCCTCAACTTGAACTTCCAGCTCGGGACCGTTCAAACCAGCAATCATCAGCAGCTACCTAGTAATATTACTGGTCAGTCGTCGTCTATGGTTAATT
ATCGTGATGGTGCTGCTGATGAGATAACGAGAAATATTAGTGGAGGTCACAATCATATGGAGATGGTGCAGGAGTTGCTTATGGTGGATGACTCCCAGGA
TGACTTTGGGTTGTTCAGATAA
AA sequence
>Lus10016814 pacid=23149146 polypeptide=Lus10016814 locus=Lus10016814.g ID=Lus10016814.BGIv1.0 annot-version=v1.0
MNDYNTGGDDQYWFDNNITVGSSDNMAAAAGTSTGNHRSSSSSSSKPIRRRSRVSKKTPITLLNTDATNFRSLVQQFTGCPHPLPPTSTSFQTAPLDTNR
GPLNLNFQLGTVQTSNHQQLPSNITGQSSSMVNYRDGAADEITRNISGGHNHMEMVQELLMVDDSQDDFGLFR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G39720 VQ motif-containing protein (.... Lus10016814 0 1
Lus10011681 15.5 0.9305
AT2G47710 Adenine nucleotide alpha hydro... Lus10006703 15.7 0.9273
AT1G35210 unknown protein Lus10036476 16.2 0.9429
AT1G56300 Chaperone DnaJ-domain superfam... Lus10029862 18.5 0.9258
AT4G17500 AP2_ERF ATERF-1, AtERF1 ethylene responsive element bi... Lus10015296 24.0 0.9385
AT3G48140 B12D protein (.1) Lus10036977 28.8 0.9379
AT2G18210 unknown protein Lus10041771 31.6 0.9231
AT5G66850 MAPKKK5 mitogen-activated protein kina... Lus10019635 33.6 0.9228
AT1G21326 VQ motif-containing protein (.... Lus10029768 35.9 0.9062
AT3G48140 B12D protein (.1) Lus10015825 41.7 0.8988

Lus10016814 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.